KEGG   Penicillium digitatum: PDIP_20390Help
Entry
PDIP_20390        CDS       T04849                                 

Definition
(RefSeq) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdp  Penicillium digitatum
Pathway
pdp00071  Fatty acid degradation
pdp00072  Synthesis and degradation of ketone bodies
pdp00280  Valine, leucine and isoleucine degradation
pdp00310  Lysine degradation
pdp00380  Tryptophan metabolism
pdp00620  Pyruvate metabolism
pdp00630  Glyoxylate and dicarboxylate metabolism
pdp00640  Propanoate metabolism
pdp00650  Butanoate metabolism
pdp00900  Terpenoid backbone biosynthesis
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
pdp01130  Biosynthesis of antibiotics
pdp01200  Carbon metabolism
pdp01212  Fatty acid metabolism
Module
pdp_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PDIP_20390
   00630 Glyoxylate and dicarboxylate metabolism
    PDIP_20390
   00640 Propanoate metabolism
    PDIP_20390
   00650 Butanoate metabolism
    PDIP_20390
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PDIP_20390
   00072 Synthesis and degradation of ketone bodies
    PDIP_20390
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PDIP_20390
   00310 Lysine degradation
    PDIP_20390
   00380 Tryptophan metabolism
    PDIP_20390
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PDIP_20390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdp04147]
    PDIP_20390
Enzymes [BR:pdp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PDIP_20390
Exosome [BR:pdp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PDIP_20390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 26230362
NCBI-ProteinID: XP_014537215
UniProt: K9H4K4
Position
Unknown
AA seq 398 aa AA seqDB search
MNPVYIVGAARTPTARIHTQLDSVPGTTLGAIAIREALRRSQVPLDLFSEVYMGQVLQAG
AGQAPAKQAAMQGGLPPEIEATTVNKVCASGLKAITLAAHNIQLGYAVAQVAGGMESMSN
VAGYLKKPEDSNCKEDPVIDGLRLDALTNSSDGRSMGACAEGVARQMGISREDQDRYALA
AYERAFRAQQNNVFQEEIIPVSVDAGTAERFDTDSLPPESLFNRLESLKPAFSPNGTVTA
GNSSSLGDGASAVVLVDAQVARQFCRENRVLAKIVACADASVAPHEFALAPTKSIQLVLE
RAQMCVEQISLWEINEAFAIVVIASQNLLGLDPDTVNVNGGAIAFGHPLGSSGCRVLVSL
LHQLTHGQYGVAVVCNGGGGATAVLIERVQSESLDVPA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagtatacattgttggggcggcgaggacccccaccgcacgtattcatacccag
ctcgactctgtgccaggcaccacactgggagctattgcaattcgtgaagcccttcgtcgc
tcacaagtgccgctggatttattctccgaggtttacatgggccaagtgcttcaagctggc
gctggccaagcccccgcaaagcaggctgcgatgcagggagggttgccaccggagatcgag
gctaccacagttaacaaagtatgcgcttctgggctcaaggccattacccttgctgcccat
aatatccaactagggtacgccgttgctcaggtggccgggggaatggagagcatgtcgaat
gtcgccgggtatttaaagaaaccagaagactccaattgcaaagaggatccggtgattgat
ggtcttcggctcgatgcgttgacgaattcctcagatggccggtctatgggcgcctgtgct
gagggtgtcgctcggcagatgggtatctcccgtgaggaccaggatagatatgcacttgct
gcctatgagcgtgcatttagagcgcagcagaacaatgtcttccaagaagagattatcccc
gtttcagtagatgcaggcacggctgaaagatttgataccgacagtctccctcctgagagc
ctcttcaatcgacttgagtctttgaagcccgcgttttcccccaatggcacggtcaccgca
ggaaattccagttcgctaggtgatggcgcttcagcggtggttctggtggacgcacaggta
gccagacagttttgtcgagagaatcgggtgttggccaaaatagtagcttgtgccgatgcc
tccgttgccccgcatgagtttgctctggcgccaaccaagtcgattcagcttgtcctcgag
agggcccagatgtgtgttgaacagatctccctatgggaaattaatgaagcgtttgccatc
gtagtgattgcttcacaaaatctactcgggttggatcccgataccgttaatgtcaacggg
ggagctatcgcgtttggacatcccttgggcagctcaggttgtcgagttctggtcagtctc
ttgcaccagttaactcacggccagtatggcgttgccgttgtctgcaatggtggtggaggt
gccacggctgtgcttatcgagcgagtccaaagcgaaagtctggatgtcccagcataa

DBGET integrated database retrieval system