KEGG   Penicillium digitatum: PDIP_28110
Entry
PDIP_28110        CDS       T04849                                 

Definition
(RefSeq) Nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
pdp  Penicillium digitatum
Pathway
pdp00910  Nitrogen metabolism
pdp01100  Metabolic pathways
Module
pdp_M00531  Assimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PDIP_28110
Enzymes [BR:pdp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PDIP_28110
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C Fer2_BFD NAD_binding_9
Other DBs
NCBI-GeneID: 26231131
NCBI-ProteinID: XP_014536272
UniProt: K9GYR4
Position
Unknown
AA seq 1030 aa
MPELDGLRYGGPIDGSSSPANQVQRQKIVVVGEKIIKHDTERKVDIVVIGEESHVAYNRV
GLSTFFEHRKIEDLYLNPTEWYDSFEERAFDHHLNTRVTAINPTAKTVQTSTGTTIDYDI
LVLATGSDATLPTHTPGHDAKGVFVYRTISDLERLIVFAAQHKGETAVTVGGGLLGLEAA
KAMTDLKTFGNVKLIDRNKWVLARQLDGDAGSLVTRKIRELGLDVVHQKRVKMVHTDEGK
NVDGITFEDGERIDCCCICFAIGVQPRDELGRDIGIQCGERGGFVIDENLQTSIPDIYAV
GDCASWENQIFGIVAPGIEMADVLAFNLTNPNKPPRSFNRPDLSTKLKLLGIDVASFGDF
FADRDGPKFLPGRRPSIVPGLGGNHPRDEPPVKALIYKDPFSGVYKKYLFTGDGKFLLGG
MMIGDTKDYLKLNQMVKLQKVLDIPPSQLILGAQNGGEENADDLNDSTQICSCHNVTKGD
VVECVENVCSHIPYSRADLYGFVAIKQLKSFVDIMKTVGKNPESLGCELCKPAIASILSS
LFNPHIMDKGFNDLQEINDKFLANIQRDGTFSVVPRIPGGEITADKLIAIGSVAKKYGLY
CKITGAQRIDMFGAKKPDLLNVWTELVDAGMESGHAYAKALRAIKSCVGTTWCRFGVGDS
VGMAIRLEERYKSIRAPHKFKGAVSGCVRECAEAQNKDFGLIATEGGFNIFVGGNGGAKP
RHAELLVADLPAEMVIPIIDRYLIFYIRTADKLQRTARWIETLPGGIKYLKEVIVDDKLG
LCADMERQMHELVDSYFCEWTETVKDPKRRKVFQQFANTDETVDTVEVVQERSQQRPTDW
PKDTSERENFKGHKWSSVSWEPVIRADCFSDEPPRVSSANVKRGDTQLAVFKIKGKFYAT
QQMCPHKRAFVLSDGLVGDDDAGKYWLSCPYHKRNFELNGEQAGRCSNDESMSIATFPVE
ERDDGWVYIQLPPIKELDLILGTKKWKVRRGEAEDPFLKVDKQFKGMKGKKVLDGFLTRD
PVQSAKSIDW
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgcctgagctggatggcctacgatatggggggcccattgatggcagttccagtcccgcg
aaccaggtccagcgccagaagattgtcgtagttggtgagaaaattatcaagcatgataca
gagcgaaaagttgacattgttgtcattggcgaagagtcccacgtagcatacaaccgcgtt
ggactttcgacgtttttcgaacatcgcaagattgaggatctataccttaatccgacagaa
tggtatgactcgttcgaagaacgagccttcgatcaccacctcaatacacgagtaacagca
atcaaccccacggcgaaaacagtccaaacctccaccggtaccacaatcgactatgacatc
ctcgtcctggcaacaggatccgatgccactctcccaacacacacacccggccacgatgcc
aaaggcgtctttgtatatcgaactatctcggacttggaacgcctcatcgtttttgcagct
cagcataaaggcgaaacggctgttacagtaggaggtggacttctagggttggaagctgca
aaggcaatgacagatctgaagactttcggaaacgtcaaattgatcgatcgcaataaatgg
gtgctagcacgacaactcgatggagatgcaggatcgttggtcactcgcaagatcagagag
ttgggacttgatgtcgtccatcagaaacgggtgaagatggttcataccgacgaggggaag
aatgtggatggcattacctttgaggatggtgagaggatcgactgttgttgcatttgcttt
gcgattggagtccaacctcgagatgaattgggtcgagacattggaattcagtgcggtgag
cgtggaggatttgtgatcgatgaaaatctgcaaacctcgatcccggatatctacgctgtc
ggggactgcgcaagctgggagaaccagatattcggaatcgttgctccgggcattgagatg
gccgatgtgctcgctttcaatttgaccaacccaaacaaaccgcctaggagtttcaaccga
ccagatctcagcacgaagttgaagcttctcggaattgacgtcgctagtttcggtgacttc
tttgccgacagagatgggccgaagttccttcccggtcgtcggccttccattgtccctggc
ttgggagggaatcatccacgagatgaaccccctgtcaaggccttaatatacaaagacccc
ttcagtggagtgtacaagaaatatttgttcaccggggacggcaagtttttgcttggtggc
atgatgatcggagataccaaggactatctgaagctgaatcagatggttaagctccaaaaa
gtacttgacattcctcccagtcaattaatccttggtgcccagaatggcggggaggaaaat
gcagatgaccttaatgacagcacccagatctgttcatgccacaatgtcaccaagggcgat
gtggtcgagtgtgtggagaacgtctgctcacatatcccttattcccgagccgatctgtac
ggcttcgtggccatcaagcaattgaaatccttcgtcgacatcatgaaaactgtcggaaag
aacccagagtcccttggttgcgaactgtgcaagcccgcaatcgcatccattctgtctagt
ctgttcaacccccacatcatggacaagggtttcaatgacttgcaggaaataaatgacaag
ttcctcgccaacatccaaagagatggcaccttctctgtggtacccagaatccccggtggt
gaaatcacggccgataaactcattgcgatcgggtccgtcgccaagaaatacggtctttat
tgtaagatcaccggtgcccagcgcatagacatgttcggtgcaaagaagccggatcttcta
aacgtctggacggaactggtggatgcgggtatggagagtggacacgcctatgcaaaggct
cttcgtgcaattaagagttgtgttggaaccacatggtgtcgtttcggtgtcggtgacagt
gtcggcatggcgattcgactggaagagcgatacaagagtattcgtgccccacacaaattc
aagggagctgtatctggttgcgtgcgagaatgtgccgaggcccaaaataaagactttgga
ctcattgccactgaaggtgggttcaacatctttgttggaggcaacggaggcgcaaagccc
agacacgccgagcttcttgttgcggacctaccagcggagatggtgatacccatcatcgac
cgctacctgattttctacatccgtaccgccgataaactccaacgaacagcacgatggatc
gaaaccctcccgggcggaattaagtacctcaaagaggttatcgtagatgataaacttgga
ctctgtgccgacatggaaaggcaaatgcacgaactcgtcgacagttatttctgcgagtgg
accgagaccgtcaaagaccccaagcgccgaaaggtctttcaacaatttgcaaatacggac
gagactgtcgacacagtcgaagttgtccaagaacgatctcagcaacggccaacagactgg
ccaaaggacacctccgaacgagagaatttcaaaggtcacaagtggtcaagcgtctcgtgg
gagccggttatccgagcagattgtttctctgacgagccaccgcgggtctcatcggcgaat
gtcaagcgcggcgacacgcagcttgctgtcttcaagattaagggtaaattctatgcaacg
cagcagatgtgtccgcataagcgagcctttgttctgtctgatggccttgttggcgatgac
gatgctgggaaatattggttatcgtgtccgtatcacaagcggaactttgagctcaacggt
gagcaggcgggtcggtgctcaaatgatgagagcatgagtatcgctacattccctgttgag
gagagggatgatggctgggtttatattcaactcccgccaattaaggagttggatttgatt
ttagggacgaagaagtggaaagtccgtaggggggaggcggaggatcctttcctcaaggtt
gataagcagttcaagggtatgaagggaaagaaagttctggatggtttcttgactcgtgac
ccggtacagtcagctaagtcgattgactggtaa

DBGET integrated database retrieval system