KEGG   Penicillium digitatum: PDIP_31980Help
Entry
PDIP_31980        CDS       T04849                                 

Definition
(RefSeq) Phospholipase A2 (PlaA), putative
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pdp  Penicillium digitatum
Pathway
pdp00564  Glycerophospholipid metabolism
pdp00565  Ether lipid metabolism
pdp00590  Arachidonic acid metabolism
pdp00591  Linoleic acid metabolism
pdp00592  alpha-Linolenic acid metabolism
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PDIP_31980
   00565 Ether lipid metabolism
    PDIP_31980
   00590 Arachidonic acid metabolism
    PDIP_31980
   00591 Linoleic acid metabolism
    PDIP_31980
   00592 alpha-Linolenic acid metabolism
    PDIP_31980
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PDIP_31980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Dehydrin
Motif
Other DBs
NCBI-GeneID: 26231518
NCBI-ProteinID: XP_014536055
UniProt: K9GWA1
Position
Unknown
AA seq 794 aa AA seqDB search
MGAARVTRLWTVPPVALAAYTAREWSQPRQFRAQFTTSRTLRNNDSESSNSNTSSDRIGE
EGKDERSIWDKIGQKLDEVKQTVGSGDWVDVGSLTDYIIPDWTRFLPATVQKLQRELSLS
PGSLADDIWKEAQDPNINPEILRDAEVRVGGDLCDEERAFRQHRQQKVVKALSSYLNIPE
EDIHPEDVPVIAMCGSGGGLRALVAGTGSYLAAQEAGLWDCITYTAGVSGSCWLQTLYHS
SVAQQDFEKLVDHLKNRLGVHIAFPPAALDLLTTAPTNKYLLSGFVEKLKGDPGADFGLV
DIYGMLLAARLLVPRGELGVSDVDFKLSNQRANLINGAHPLPIYTAVRHEIPVEAIDHPN
EKTKKHPTPEDLVKEARKEAWFQWFEFTPYEFFCEELNAGIPTWALGRHFNAGRSEVSAE
NLPLPEMRITGLMGVWGSAFCATLSHYYKEVRPVIRGLAGFGGIDSLIQGKNQDLIKVHP
IDPAGIPNYVMGMKDQLPNSCPESIFRNEHLRLMDAGMSNNLPIYPLIRPGRDVDVIIAF
DASADVKQENWLSVVDGYAKQRGIKGWPIGTGWPKISSLKDTENALREPENITKEQITEK
LTNAKNQFGTQPANQKPTSSTDLGYCNVWVGTTEERTSNNKPPPSKRLFDTSHSEDHSES
DFHLMRPDAGIAVIYFPLIPNPSAPQIPPKAKTRSRVAAQSMRQDSSQTKDPELPLAPQP
NSIDPAVDDFLSTWNFIYTPEQIDSVIGLAKANFSEGEEQTRRVVRAVYERKKSDRLQKE
AAEIRKKMEGFVPL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctgccagggtcactcgtctgtggacggtaccccccgttgcgctagctgcatac
actgcaagggaatggtctcaacccagacaatttagagctcaattcactacttctcgaaca
ctacgcaacaatgattcagagtctagcaattcaaatacgagctcagatagaattggtgag
gagggcaaggatgagagatccatctgggacaaaatcggccaaaagctcgatgaggttaaa
caaactgttggctccggcgattgggtagacgtgggtagtcttacagactatattatccca
gactggacgcgatttttaccagctactgtccaaaagctgcagcgagagctttccttgtca
ccaggctccctggcagacgatatctggaaggaggcgcaggaccctaacatcaatccagaa
atactccgcgacgccgaggtacgagtaggtggggacctctgcgacgaagagcgggcattt
agacagcatcgacaacagaaggttgtcaaagcactgtcatcctacctcaacataccggag
gaggatatccaccccgaagatgtaccagtcattgcgatgtgtggctcaggaggtggtctg
cgcgctctagttgcaggcaccggatcttacctggctgcacaggaagcagggctgtgggac
tgtataacctacacagccggtgtcagtggcagttgctggctgcagaccctgtatcattcg
tccgttgcgcagcaagactttgagaagcttgtcgaccatttaaagaatcgtcttggtgtt
catattgcattcccgccggcagctctcgatctcctcactactgcgccgacaaacaagtac
cttctcagtggttttgtggaaaagcttaaaggcgaccctggagcggactttggattggta
gatatttacggaatgctgcttgcagcgagactcttggtcccgcgaggagaactcggagtc
tccgatgtggatttcaagttgtcgaaccagcgagccaatttgataaatggggcgcatccg
ctacccatctacacggcggtgcgacatgagattcctgtcgaagccatcgaccacccaaac
gaaaaaaccaagaagcatccaacgcccgaagatttggtgaaagaggcacggaaagaagca
tggttccagtggtttgagttcactccctacgaattcttctgtgaagaactcaatgccggt
attcccacctgggctttgggacgtcacttcaacgcaggtcgctctgaggtttctgctgaa
aacctccccctcccggagatgagaattactgggctcatgggtgtttggggtagcgctttc
tgcgcgactttgtctcactattacaaggaggtccggcctgtgatcagaggcttggctgga
tttggtggaatcgactctctcatccaaggcaagaaccaagatttgatcaaggtgcatccc
atcgaccctgcgggtatacccaactacgttatgggcatgaaagaccagctgcccaactcc
tgtccagagtcgatttttcgaaacgagcacttgcgtcttatggatgcgggaatgagcaac
aatctgccaatctacccactcattcgacctgggcgtgatgttgacgtgatcatcgcattt
gatgcatctgcagacgttaaacaggagaactggctttctgtggtcgatggatacgccaaa
caacgtggtattaagggttggcctatcggtaccggatggcctaaaatttcgagcctcaag
gatactgaaaatgccctccgcgagccagagaatatcaccaaggagcaaataacagagaaa
cttaccaacgccaagaatcagtttggaacccagcccgctaatcaaaagcccacatctagc
acagacctgggctattgcaatgtttgggtcggcaccacggaagagcgaacctcgaacaac
aagcctccaccatccaaacgcctatttgatacttcccacagtgaagatcattccgagtcc
gacttccacctgatgcgaccagatgccggaatcgcggttatctacttccctttgattccc
aatccttccgcaccacagatccctcccaaagccaaaactcgttcgcgcgtggctgctcag
tccatgcgacaggatagctctcaaaccaaggacccggaattgcccctcgctccacaaccc
aactcgatcgaccctgccgttgatgatttcctgtccacttggaacttcatctacacgccc
gagcaaattgattccgtcattggtcttgcgaaggcaaacttctccgagggcgaagaacag
actcgccgtgttgtccgtgctgtctatgagcgcaagaaatccgatcgactgcagaaggag
gcggcagagattcggaagaagatggaaggctttgtgcctctgtga

DBGET integrated database retrieval system