KEGG   Penicillium digitatum: PDIP_39030Help
Entry
PDIP_39030        CDS       T04849                                 

Definition
(RefSeq) HAD superfamily hydrolase, putative
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
pdp  Penicillium digitatum
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pdp01009]
    PDIP_39030
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     PDIP_39030
Protein phosphatases and associated proteins [BR:pdp01009]
 HAD phosphatases
  Other HAD phosphatases
   PDIP_39030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase NIR_SIR NT5C Hydrolase_like Stimulus_sens_1
Motif
Other DBs
NCBI-GeneID: 26232221
NCBI-ProteinID: XP_014535735
UniProt: K9GM77
Position
Unknown
AA seq 291 aa AA seqDB search
MASTSAPPRIRACLFDMDGLLIDSEDLYTKVTNEILQKYGRPNLPWSIKAQLQGRPQPEA
AKIFNDFAQLPISEEELKEEQSSRQRQYFPQTQPLPGVPTLLSNLVSTLSTDEPVYIALA
TSSHRSNYKLKTDHLKELFSVFPEPNKVLGDDPRIGKGRGKPLPDIYLLALETINIELRS
KGKADIKPEECLVFEDAVPGVEAGRRAGMQVAWCPHPGLLEAFKGREDEVLAGATGSHKE
EEKTDAQKEAEELQAWRLRGSGTPGKIGDGFGQLYSTLEDFPYARYGIRIL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcttccactagtgctcctcctcgcatccgagcatgtctctttgacatggacggcttg
ttgattgactcggaggatttgtacaccaaagtcacgaacgaaatcctccagaagtatgga
agaccaaatctcccctggtcaatcaaggcccagctgcagggtcgcccccagccggaggcc
gccaagatctttaacgactttgctcagctgcccattagtgaagaggagctgaaggaggag
caatcaagtcgtcagcgacaatacttcccacagacacagccactccccggtgtaccgact
cttctatccaatctcgtgtcgacactgtcaaccgacgagcctgtatacattgcgctagct
acatcatcccacagaagcaactacaaattaaagactgatcatctgaaagagctgttctcg
gtgtttcctgaacctaacaaggttcttggtgacgatccgcgcatcggcaagggccgaggc
aagcctcttcctgatatctacttgcttgctctggagactatcaatatcgaactgcgcagc
aaggggaaggcagatatcaagccggaggagtgtctcgtgtttgaggacgcggttccgggc
gttgaggctggtcgtcgcgccggcatgcaggttgcctggtgccctcacccgggtctccta
gaagccttcaagggccgggaggacgaagttctcgctggagccacgggttcgcataaggag
gaggagaagacggatgctcaaaaagaggcagaggagctccaggcctggcgtttgcggggt
tctggaacacctggcaagatcggcgatgggtttggccagctctattccaccctggaagac
ttcccgtatgcgagatatggcattcggattctctga

DBGET integrated database retrieval system