KEGG   Penicillium digitatum: PDIP_47890Help
Entry
PDIP_47890        CDS       T04849                                 

Definition
(RefSeq) A-pheromone processing metallopeptidase Ste23
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
pdp  Penicillium digitatum
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdp01002]
    PDIP_47890
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     PDIP_47890
Peptidases and inhibitors [BR:pdp01002]
 Metallo peptidases
  Family M16: pitrilysin family
   PDIP_47890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C Peptidase_M16
Motif
Other DBs
NCBI-GeneID: 26233106
NCBI-ProteinID: XP_014533783
UniProt: K9FV00
Position
Unknown
AA seq 1106 aa AA seqDB search
MAQIERITENLEKPELDDRSYRVIRLPNKLEALLVHDPDTDKASAAVNVNVGNFSDEDDM
PGMAHAVEHLLFMGTKKYPKENAYNQYLASHSGSSNAYTAATETNYFFEVSATGDSSAPK
SSEDNTPAETNDNNGIVSNGIGSDGKSPLYGALDRFAQFFVAPLFLESTLERELQAVDSE
NKKNLQSDLWRLMQLNKSLSNPKHPYSHFSTGNLQTLKEEPQKRGLEVRSEFIRFYEKHY
SANRAKLVVLGRESLDTLEQWVSELFSDVENKNLAQNRWDDVQPFTEKEMCTQVFVKPVM
DTRSMDMYFPFLDEEDLHDTQPSRYISHLIGHEGPGSVLSYLKAKGWANGLSAGAMPVCA
GSAFFTISVRLTPEGLKQYQEVANVVFEYIAMIKQREPEQWIFDEMKNLAEVDFRFKQKT
PASRFTSRLSSVMQKSIPSEWLLSGSLLRRFDSDLIKKALSYLRADNFRLVVVSQEFPGT
WDQKEKWYGTEYKVEKIPKEFLGGLQKALKSTEATRTSNVHLPHKNEFVPTRLSVEKKEV
AEPENTPKLIRHDDRVRLWFKKDDRFWVPKATVEVTLRNPLVWATPANLIKTKLYSELVR
DSLDEYSYDAELAGLDYHLSANILGLDISVSGYNDKMSALLDKVLNTMRGLVIDQDRFHI
IKERLTRAFRNAEYQQPYYQVGDYTRYLLAESSWVNEQYLEELEHVECDDVVKFSPQLLE
QTHIEVLAHGNLYKEDALRMTDSIEKILGGRPLPPSQWYLRRNMTLPPGANYVYPRSLKD
PANVNHCIEYYLYIGLFSDDVLRSKLQLFAQLTDEPAFDQLRSKEQLGYVVWSGARYNAT
TLGYRVIIQSERTAQYLESRIDTFLRQFGPILEKMPEEDFEGHKRSVVNKRLEKLKNLSS
ETGRYWSHIGSEYFDFLQHETDADNVRTLTKADLIAFYRQYIDPSSATRAKLAIHMNAQS
GAQVEAPNPAEQRTRLVEVVTEHLEAADFIVDSARFAKAFDEVDATAADKSQVIFAVKDF
LATETGLSKQKIEPVLETLDEKLSSQLKELGLGSSSDTQSATTGNGEAQKAVVITDVPSF
KARLPVSTGPVSVTDLSEYEDFDAKL
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatcgagcgtattacagagaacttggagaaaccggagcttgatgatcgttct
tatcgagtgatccgtttgccaaacaagcttgaggccctcctagttcatgacccggacacc
gataaggccagtgccgccgtcaatgtcaatgtgggcaatttctccgatgaagatgatatg
ccaggaatggctcatgcagtagagcacttgctgttcatgggcacaaaaaagtatccgaag
gaaaatgcgtacaaccagtacctagcgtcccactctggttcgtcaaatgcctacacagcc
gccaccgaaacgaactacttcttcgaagtgtccgccacaggtgactccagtgcccctaaa
tctagtgaagacaacacccctgccgagacgaatgataacaatggcatcgtgtcgaatggg
attggttcagatggaaagtcacccctctatggtgcattggatcggtttgcccaattcttt
gttgcaccactgttcctagagtcaaccctagaacgggagctacaggcggtggattcggaa
aataaaaagaaccttcaaagtgacctgtggcgtttgatgcaactgaacaagtcgctttcg
aaccctaaacacccctacagccacttctcaaccggcaatctgcagaccttgaaagaagaa
ccacagaaacgtggtctggaagtccgcagtgagttcatcaggttttatgagaagcactac
tcggccaaccgggcgaagttggttgtcttggggcgggagtctctcgacacgctggaacag
tgggtctctgagctcttttctgatgtcgagaataagaatctcgctcagaaccgctgggac
gatgttcagcccttcactgagaaggaaatgtgcacccaggtgttcgtgaagccggtcatg
gatactcgatccatggatatgtacttccccttccttgatgaagaggatttgcatgacacc
cagcctagtcggtatatcagccatctcattggccatgagggcccgggcagcgttctttct
tatcttaaggccaaggggtgggccaatggtctgtctgcaggcgcgatgcctgtctgcgct
gggtcagcctttttcacaatctcggtgcgcctgacgcccgaaggtctgaagcaataccag
gaagtcgcaaatgttgtcttcgagtatatcgctatgatcaagcagcgcgagcccgagcaa
tggatcttcgacgagatgaagaaccttgccgaggtcgatttccggttcaagcagaagacc
ccggctagtcgcttcaccagccgtttgagcagcgtgatgcagaagtcaatacctagtgaa
tggctactgagcgggtctttgttgcgaagatttgactctgatttgatcaaaaaggcgctg
agctatctgcgggccgacaacttccgcctggtcgttgtgtcccaggagttccccggtaca
tgggatcagaaagagaagtggtatggcacggaatacaaggtcgagaaaatcccaaaggag
ttcttgggcggtcttcagaaggctctaaagtcgactgaggctacccgcacttccaacgtg
cacttgcctcacaagaacgaatttgtgccgactaggctatcggtggaaaagaaggaggtt
gccgagcccgagaacacccctaaactgattcgccacgacgaccgggtgcgcctgtggttc
aagaaggatgaccgtttctgggtacccaaggccactgttgaggtaacacttcgcaatcct
ttggtgtgggctacacccgccaatctcatcaaaacaaagctgtacagcgagttggtgcga
gactcattggatgaatactcctacgacgcggagcttgctggtttggactaccacctctcg
gcgaacattttgggcttggacatttccgtgagcgggtacaacgacaagatgtccgctctt
ttggacaaagtactcaatacaatgcgtgggctagtgatcgaccaggatcggttccacatt
atcaaagagcgcttgacgcgggcattccgcaacgccgagtatcaacagccttactaccag
gtgggggattacactcgctacctccttgccgagagcagctgggtgaacgagcagtatctt
gaggagctggagcatgttgagtgcgatgacgtggtcaaattttccccccagttgcttgaa
cagacccacatcgaagttctggcccacggaaatctgtacaaggaggatgctctgcgtatg
acggactctatcgaaaagatcctggggggccgtcctctgcccccgtcgcagtggtacttg
cgccgcaacatgaccttgccgcccggtgccaactatgtctacccccgctcacttaaggat
ccggccaacgtcaatcactgcatcgagtactacctctatattggactcttttccgatgac
gtcctgcggtcaaagctccaactgtttgcgcagctaactgacgaacctgctttcgaccag
ctgcgcagcaaggaacagcttgggtatgtggtgtggagtggtgcacgctacaacgccacc
accctgggctaccgggtcattatccaaagtgagcgcacggcacaatatctggaatcgcgc
attgacactttcctccgccagttcggtcctattctcgagaagatgcccgaagaagacttc
gagggtcacaagcgtagtgtcgtgaacaagcgcctggagaaactcaagaatctaagctct
gagactggccggtactggtcgcacatcggatcggaatactttgatttcctgcagcatgag
accgatgcggataatgtgcgcaccttgaccaaggcggatctcattgcattctaccgccaa
tacatcgacccatcttcggcaacgcgcgccaagctcgctatccatatgaacgcccagtca
ggcgcgcaggttgaggcgcccaacccagccgaacagagaacacgccttgtcgaagtcgtt
accgagcacctcgaagctgctgacttcatcgtggattctgcccgcttcgcgaaggcattc
gatgaggttgacgcgacagcggcggacaagtcccaggttatctttgcggtgaaggacttc
ctggcgaccgagacgggcctgtcaaagcagaagatagaacctgtccttgagacactggat
gagaagctcagttcccaattaaaggaactgggtcttggttctagcagtgacactcagagt
gcgaccactggcaatggcgaggctcagaaggccgtggttatcactgatgtgccgagcttc
aaggcccgtctgcctgttagcactggccctgtttctgtcacggatttgagtgagtatgaa
gattttgatgccaagctataa

DBGET integrated database retrieval system