KEGG   Penicillium digitatum: PDIP_48850Help
Entry
PDIP_48850        CDS       T04849                                 

Definition
(RefSeq) Methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
pdp  Penicillium digitatum
Pathway
pdp00670  One carbon pool by folate
pdp01100  Metabolic pathways
pdp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PDIP_48850
Enzymes [BR:pdp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     PDIP_48850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 26233202
NCBI-ProteinID: XP_014533879
UniProt: K9FXA7
Position
Unknown
AA seq 691 aa AA seqDB search
MEKKITEKIAALPQDANYFSLEFFPPKTRMGFANLSARLERMAQALRPLFVTVTWGAGGS
TAARSLELAEVCQRQLQLTTVLHLTCTNMSRKLVDMALDEAKALGIRNILALRGDPPRSE
EYNMHGEDDSNKDFTFAVDLVRYIRQTHGDYFCVGIAAYPEGHPADTFQDLQDPVRDIPY
LVEKTLAGADFIMTQLTYDIEAYQKFENTLRNHESGAFKTIPIIPGLMPIHSYKILTRVT
KLSHVTIPPPIARRMEELKHDDEAVKRAGVDIVSEIVGGIRDIPSPGPRGFHFYTLNLEK
TVSFILEQCDLIPSYSDAGDLAIEDDPASIPLDFPGRALRRRRASSINSQPHNRVVVDKL
SVHGSSQDSVHEARADSAGVPAPPPSRSTTLLISEGLGALGREATWDDFPNGRWGDARSP
AFGEIDGYGPSLHVTANSARRLWGHPVDSKDMSTIFRRHVSGELHMVPWSEGGAEEDGEG
LNAETELIRPELLKLIDGRGWWTLASQPAVNGVHNDHPIFGWGPQREGFVFQKPFVEFFC
SSNDYTNILKPMFAKHGHDKLTWFATNIKGDFESSLPIQPADVELDDLGSNPESVNAVTW
GVFRGKEIVTPTIIEEVSFRAWGEEAFRIWDEWRRIYPRGSPTEAYLDTTKNDSWLVCVV
GQQFGAGTKQGSKEEEDEVKWMWRVLAGEEV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaagatcactgagaagatcgcggctctgccgcaggatgccaactacttttcc
ttggagttcttccctccaaagacccggatgggttttgctaacttgtccgcgcgtctggag
cgaatggcccaagcactgcgtcctctgtttgttacagtcacctggggtgctggtggtagc
actgcggcacgatcgctcgagctggcggaagtatgccagcgccaactgcagttgacgacc
gtcctgcatctgacctgtacaaacatgagccgcaagctggtggatatggctctagatgag
gccaaggctctcggaattcgcaacatcctagccctacgaggagatccgcctcgcagtgag
gaatacaatatgcatggagaggatgatagcaacaaggatttcacttttgccgttgatctt
gttcgatacattcgccagacacatggtgactacttctgtgttggtattgccgcatacccg
gagggccatcctgcggacaccttccaagacctccaggatcccgtcagagatattccttac
ctggtcgagaagacattggctggagcagattttatcatgactcaacttacctacgatatc
gaagcttaccaaaagttcgagaacacgcttcgcaaccatgagtccggtgctttcaagact
attcccatcattccgggcttaatgcccatccacagctacaagattttgaccagggtgact
aagctcagccatgtgacgatcccacctcccattgccagacgtatggaagagttaaagcac
gacgacgaagcggtcaagcgcgcgggtgtggatattgttagcgaaattgtgggtggtatt
agggacatcccctccccgggcccccgaggatttcatttctacaccttgaatttggagaag
acagtatcattcatcctggaacaatgcgacttgattccgtcttactctgatgctggagac
cttgccattgaggacgatcccgcatcgattccactcgatttccctggacgtgcgttgcga
agacgccgtgcgtcctctatcaactcacaaccccacaaccgcgtcgttgtcgacaagcta
tctgtccacgggtcatcgcaagattccgtccatgaggctcgcgcagacagcgcaggcgtg
cccgcacccccgccaagccgcagcacaactcttcttatctccgagggtctcggtgccctt
ggcagggaagcaacatgggatgacttccccaatggacgatggggtgatgctcgctcgcct
gcattcggtgagattgatggatatggaccctcgcttcatgtcactgccaactccgcacgt
aggctatggggccacccggtggactccaaggatatgagtacaatcttccggcgccacgtc
tcgggagaactacacatggttccgtggtcagagggcggtgccgaagaggacggtgaaggt
ttgaatgcagagacggagctaattcgaccggagctgttgaagctaattgacggccgcggc
tggtggacactggcctcgcagcccgcagtgaacggtgtacacaacgaccaccccatcttc
ggctggggccctcaacgagaaggcttcgtcttccaaaagccatttgtggagttcttctgc
tcgagcaacgactacaccaatatcctgaagccaatgtttgctaagcacggccacgacaag
ctcacctggttcgcgacaaacatcaagggcgattttgaatcctcactcccaatccagcct
gctgacgtggagctcgacgaccttggctctaatcctgagagtgtcaacgctgttacctgg
ggtgtattccgcggaaaggagatcgtcacccccaccatcatcgaggaagtgagtttccgc
gcttggggcgaggaggcattccgaatctgggatgaatggcgtcgcatctacccccgcgga
tcgcctactgaagcctacctcgacacaaccaagaacgactcttggcttgtgtgtgttgtc
ggtcagcagttcggtgccggtactaagcagggctccaaggaggaggaagacgaggttaag
tggatgtggcgggtcttggcgggcgaggaggtttaa

DBGET integrated database retrieval system