KEGG   Penicillium digitatum: PDIP_51560Help
Entry
PDIP_51560        CDS       T04849                                 

Definition
(RefSeq) Palmitoyltransferase pfa5
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
pdp  Penicillium digitatum
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PDIP_51560
Enzymes [BR:pdp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     PDIP_51560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 26233473
NCBI-ProteinID: XP_014534150
UniProt: K9GIE8
Position
Unknown
AA seq 427 aa AA seqDB search
MASPAQKRANVVVSRLIPPVLLGAVIYASYAVTKPLCIDYLIHPLSSYNKTPRVGAGAAI
IAIYYVLLFPMVVSYTHLYYQVLWNPGYLPLGEQKVADDENAKQSKRRRGKKSTCKSDPE
KTDQADTDVERGSVSTAVDTAVQLGIGLESFYTKDVFVCQADGRPPWCTTCSQYKTDRAH
HCCELGRVGGVVSETSFKFFIQFVAYTSIFCAFVLIVCAYFTAEIRRQTGGVNPHWCVCI
GLSSFFAFFAAGMTLSSVQMAIFNITTIENLNRRTAVWTLAIRVPEHLLERLWVVESPWA
PTFRMVSYPLPAPTSSTKPQTTNLSPDEDRHVFAIIQTLPGENPFDLGSPLKNLQQVMGY
NVFDWLLPIKKSPCADHNSMESHFALGPVVTRLRLEAGLIPPLENGAAVPQSSHSGRSHR
EKSPSYE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcccgcgcagaagcgcgccaacgtcgtagtatccaggctcattccacctgtg
ctactcggcgcagtgatatacgcttcctacgcagtcacgaaaccgttatgcattgactat
ctaatccacccgttatcctcctataacaaaaccccccgagttggcgctggcgccgcgatc
atcgcgatctattacgtccttctatttcccatggtcgtttcatacacgcatctttattat
caagtcctgtggaatcccggataccttcccctcggtgaacaaaaagtggcggatgatgag
aatgcaaagcaatcgaagcgccgtcgtgggaagaaaagcacgtgcaaatccgaccccgag
aagacagaccaggcggacacagatgtggagagaggctcagtctcaactgctgtagacacg
gcagtccaattaggtattgggttggagagcttctatacaaaagatgtttttgtctgccag
gcagacggccggcccccatggtgcactacctgcagtcagtacaagacagacagggcgcac
cactgctgcgagctgggtcgggttggaggtgtggtgtccgagacatcgttcaaattcttc
attcaatttgttgcttataccagcatattctgtgcctttgtactcatcgtgtgtgcttat
ttcacagcggagattcgacgccagaccggaggagtaaacccccattggtgtgtctgcatt
ggactgagcagttttttcgcattttttgccgccggaatgaccctgagctcagtccaaatg
gccatcttcaatatcacaacgatcgaaaacctaaaccgacgcaccgccgtctggaccctc
gccatccgtgtcccagaacacctcctcgagagactctgggtagtagagtccccttgggcc
ccgacattccgcatggtctcctacccactaccagcaccgacgtcttcaaccaaaccgcaa
acaacaaacctttccccagacgaagaccggcacgtctttgctatcatccaaactctgccg
ggcgagaatcccttcgatctaggcagcccattgaaaaatctccagcaggtcatgggatac
aatgtatttgattggctactgccgatcaagaagagcccatgcgccgaccacaacagcatg
gaaagtcattttgccctgggacccgtggtgacccgcttgcggctggaggctggactgatt
ccgccgctcgagaatggggctgctgttccgcagtcttcacattcggggcgcagccaccgg
gaaaaatctcctagctatgaatag

DBGET integrated database retrieval system