KEGG   Penicillium digitatum: PDIP_63500Help
Entry
PDIP_63500        CDS       T04849                                 

Definition
(RefSeq) Aspartyl-tRNA synthetase, cytoplasmic
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
pdp  Penicillium digitatum
Pathway
pdp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PDIP_63500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pdp01007]
    PDIP_63500
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pdp03016]
    PDIP_63500
   03029 Mitochondrial biogenesis [BR:pdp03029]
    PDIP_63500
Enzymes [BR:pdp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     PDIP_63500
Amino acid related enzymes [BR:pdp01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   PDIP_63500
Transfer RNA biogenesis [BR:pdp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PDIP_63500
 Prokaryotic type
   Other AARSs
    PDIP_63500
Mitochondrial biogenesis [BR:pdp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PDIP_63500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 DUF2156 tRNA_anti-codon tRNA-synt_2d MCM_N GerPC
Motif
Other DBs
NCBI-GeneID: 26234666
NCBI-ProteinID: XP_014533576
UniProt: K9FJC1
Position
Unknown
AA seq 967 aa AA seqDB search
MSIKRALSKAIRGHLGGDDDSSGSNIRSALPPRILPSQSRSGSPTASPRRSILGNFLRDK
NEYISSSDDVSDDSSSGGLSKNQQKRLVRQHRRSERSRLSEEMFSETDRRHKEEEVAKSA
AEETPEMKARYGELPLMQSATRTGELRTRIDDITLAMEGQQVFFSARLHVIRRMSAKLVF
LVFRQQLGTFQGVLHERAGISSLAMIQWVEHLRVGSFVTVRGTIQKPEVPVLGCSIHDVE
LAVDSVHLQVRREEPVPFSVYEAEIRTKEEEKAEGRRNHIPDRTRLANRILDLRTSTSQS
VFRIQSATCNLFRVALDDRDFIEIHTPKLQGAATESGASVFQVNYFGRPAFLAQSPQLAK
QMAIAADFGRVYEIGAVFRAENSNTHRHLTEYTGLDLEMAIDEHYHEMLETLDAVIKNIL
KGIYTKYRREVELVKYQFPSEDVVWLEKTPIIRFTDGIKMLNDSGWLNEDGEQLPLDEDL
GTRDEIRLGELVKEQYGTDYYVLDKFPRGARPFYTMPDAEDDRYTNSFDMFIRGQEIVSG
GQRIHDAHMLEENMRRVGINPDDMEEYLEGFRWGAPPHAGAGVGLERIVMLILKLGNIRL
TSLFPRDPKSLPAKPVSEQLRHPESSTIEPPWHREHKARVASDPSELQPLEHLVANYGDA
TSTSWFDDRFKIWRDMATGAAVAYVPSSSNFAIIPGNPACDPKQYTRTITQFLQWMRRET
KYKPVWILCSPEVETILGERLGWRSLSCIAEERVDPSRNQAASDGEIARKLRRAETEGIK
LVSMNQGEMVPDDIRKKIDERISEWLSNRKGTQVHLSLIRPWCDSEHRWYFYALDKNGIV
CAFVALAMLSPAHGMQVKYSLDFPGAPNGAIEYIVTHAIQTAAKSGVKGLTFGAGATSQL
TAGHNMHGTKVKMLEHTYEALAKQFHLVRKSEFRAKLGATEDPLYISYPTHGLGSKGIRA
ILNFFED
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattaaacgtgccctctctaaggccatcagaggacacttgggaggtgatgatgac
tcctccgggtccaacattcgttctgccctgccacccaggattcttccctcccaatctcgg
tctggttcccccaccgcatcccctcgtcgcagcattctcggcaacttcctacgggataag
aatgagtacatttcttcatccgacgatgtctctgacgactcatcctccggtggcttgagt
aaaaaccaacaaaagcggttggtgcgtcagcaccgtcgaagtgagcgcagtcgtctcagc
gaggagatgttctccgagactgaccgccgccacaaggaagaggaggttgccaaatccgca
gccgaggagacgcctgagatgaaagcgcggtatggtgagcttcccttgatgcagtcagcc
actcgaacaggagaactgcggactcggatcgatgacataactcttgccatggagggacag
caagtgtttttcagcgcacgactgcacgtcattcgtcgaatgagtgccaagctagtgttc
ttggtattccgccagcagctaggtaccttccaaggtgttttgcatgagcgggcggggatc
tcgtctctcgccatgatccagtgggtcgagcatcttcgagtgggctcttttgtcacggtc
cgcggcactatacagaaacccgaggttccagttttgggctgctcaattcatgacgttgaa
ctggccgtggactcggttcacctccaggttcgccgcgaggaacctgtccccttcagtgtc
tacgaggcagagattcggaccaaggaagaagaaaaggccgagggccgccgtaaccatatc
cctgatcggacacgtttggccaaccgaatccttgaccttcgcacgtcaacatcgcaatcc
gtcttccgtatccagtctgcaacatgtaatttgttccgtgttgcccttgacgaccgtgat
tttatcgaaatccataccccgaagctgcaaggcgccgctacggagtctggagcgagtgtc
ttccaagtcaactatttcggccgccctgcattccttgctcagtctcctcaattggcaaag
cagatggctatcgcagctgatttcggtcgtgtctacgagatcggtgctgttttccgtgcc
gaaaactccaatactcaccgccatcttacagaatatactggattggatcttgagatggct
atcgatgagcactaccacgagatgcttgagactcttgatgctgtgataaagaatatcctc
aagggtatctacaccaaataccgccgcgaggttgagcttgtcaagtaccagtttccctcc
gaagatgtcgtgtggctggaaaagacgccgatcattcgtttcaccgatggtatcaagatg
ttgaatgactcgggctggttgaatgaagacggcgagcagctacctttagacgaggacctg
ggtacccgtgatgagattcgcctgggtgaacttgtcaaggagcaatacggcaccgattac
tacgtccttgacaaattccctcgcggtgcccgtcccttctatacgatgcccgacgccgaa
gacgacaggtacaccaactcttttgacatgtttattcgtggacaagagatcgtctcgggt
ggtcaacgtatccacgatgcccacatgctcgaggaaaacatgcgtcgtgtgggcatcaac
ccggatgatatggaggagtatctggagggcttccgctggggcgccccgcctcacgcgggc
gccggagttggcctggaacgaatcgtgatgcttatacttaaattgggcaacatcagattg
acatcactgttccctcgcgaccccaagagtctgccagcgaaacctgtctctgaacagctc
cgccatccagaatcatctactatcgaaccaccgtggcaccgcgagcacaaggcccgggta
gcttcagatcccagtgagctgcagcctctggaacatttggtcgctaattacggcgatgcc
acatccacctcctggtttgatgaccgctttaagatctggcgtgacatggcaactggtgca
gctgtcgcctacgtgcccagctccagcaactttgccatcattccgggtaacccggcctgt
gacccaaagcagtacacacgcacaattacacaattcttgcaatggatgcgccgcgagacc
aagtacaagcccgtgtggatcctctgctctcctgaggttgagactatacttggcgagcga
ctaggctggcgcagcctgtcctgtatcgccgaagagcgcgttgacccatcgcgcaaccag
gccgcttctgacggcgagattgcacgtaagctgcgtcgcgctgaaaccgagggcattaag
ctggtctccatgaaccaaggcgagatggtaccagacgatatccgcaagaagattgacgag
cgtatcagcgagtggctatccaaccgcaagggcacgcaagtgcacctgtccctgatccgc
ccatggtgcgactcggagcaccgttggtacttctacgctctggacaagaacggcatcgtc
tgcgccttcgtcgctttggctatgctatctcctgcccacggcatgcaagtcaagtacagt
cttgatttcccgggcgcacccaacggtgctatcgaatatattgtcacgcatgcaatccag
accgccgccaagagtggcgtcaagggtctcacatttggcgctggcgccacttcccagctc
accgctggccacaacatgcacggaaccaaagtcaagatgctggagcatacctacgaagcc
ctcgctaagcagttccatcttgtgcgcaagagtgaattccgggctaagctcggcgccact
gaggacccgctgtacatctcctacccgacccacggcctgggctccaagggtatccgtgcg
atcctgaacttctttgaagattaa

DBGET integrated database retrieval system