KEGG   Penicillium digitatum: PDIP_64750Help
Entry
PDIP_64750        CDS       T04849                                 

Definition
(RefSeq) Fatty acid activator Faa4, putative
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pdp  Penicillium digitatum
Pathway
pdp00061  Fatty acid biosynthesis
pdp00071  Fatty acid degradation
pdp01100  Metabolic pathways
pdp01212  Fatty acid metabolism
pdp04146  Peroxisome
Module
pdp_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PDIP_64750
   00071 Fatty acid degradation
    PDIP_64750
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PDIP_64750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pdp01004]
    PDIP_64750
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdp04147]
    PDIP_64750
Enzymes [BR:pdp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     PDIP_64750
Lipid biosynthesis proteins [BR:pdp01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   PDIP_64750
Exosome [BR:pdp04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   PDIP_64750
  Exosomal proteins of breast cancer cells
   PDIP_64750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C CdhD
Motif
Other DBs
NCBI-GeneID: 26234791
NCBI-ProteinID: XP_014533701
UniProt: K9G3K0
Position
Unknown
AA seq 686 aa AA seqDB search
MVKKGPFSVEAPGYERVPGETIPRRHPKAKDGLITTLEDVSTTYENMRRSARVFGNSKAV
GSRRLIKTHVENKKVKKIVDGVEQEIDKKWTYFEMSGYTYKTFLEYEKLCLELGSGLRKL
GLEKDSKIHLYGATSAHWLAMSHGAASQSVTIVTAYDTLGEEGLKHSIVQTGSTAIFLDP
GLLKSLIGILRSVPSIKHIIYNTDTEIDQKLIGQLHSEFVDINVQSIEELRKQGEENLVE
PVPPKPEDLCCIMYTSGTTGPPKGVPLTHANVIAATAGVHTVIGPCVNHTDSLLTYLPQS
HILEFMFENLCLFWGGTMGYGNPRTLSDASMRNCLGDIKEFKPTVLVGVPAVWESVKKGV
LANLNKASFVVKSLFWGAMSAKSFLLSTGFPGANLGASVLDAVVFKKLKEATGGKLRVVM
NGGGPVSKDTQRFLSMAIAPMISGYGLTETSAMGALNDPLAWNPDALGEVPASIEVKLVD
FPDAGYLTSNNPPQGEIFIRGGSVTSGYYDNEEETKAAITEDGWFMTGDIGEFDPNGHLK
IVDRKKNLVKTLNGEYIALEKLESVYRSSPVIGNICVYAAEDQDKPVAIIVPAEPALKKL
AHENGIEGDTLESLVHDEKLNKIVLQQLQATGRAGGLRGIEIINGVVLSDDEWTPQNGFM
TAAQKLQRKKILARYESKISMAYGKK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaagggccccttctccgtcgaggcgcccggatatgagcgtgttcccggcgag
acaatcccccgtcgacaccccaaggccaaggacggcctgattacgacactcgaagatgta
tctaccacctatgagaacatgcgccgatcagctcgcgttttcggtaactccaaagctgtc
ggcagtcgccggctaatcaagacccacgttgagaacaagaaggtcaagaagatcgtggat
ggtgttgagcaggagatcgacaagaagtggacctattttgaaatgagtggttatacttac
aagaccttcctcgaatatgagaagctctgtttggagcttggtagcggtctccgcaagcta
ggcctcgagaaggacagcaaaatccacctctacggtgcgacgagcgcacactggctagcc
atgtcacacggggctgcctctcagtccgtgaccattgttactgcatacgataccctaggc
gaagaaggcttaaagcactctatcgttcaaaccggcagtactgccatcttcctcgacccc
ggtctgctgaagtcgctcatcggcatcctccgcagcgtgccctcaatcaagcacattatc
tacaataccgacacggaaatcgaccagaagcttattggacagttacacagcgagtttgtt
gacatcaacgtgcagagcatcgaggaattgcgcaagcaaggcgaggaaaatctcgtggag
cctgttcctcccaagccggaagacttgtgctgcatcatgtacacctcgggcacaacaggc
ccgccgaagggtgttccattgacccacgccaatgtgatcgctgctactgctggtgttcac
accgtcatcggtccctgtgtcaaccacacggactccctcctgacctacctccctcaatct
cacattctggaatttatgtttgagaacctgtgcttgttctggggtggtaccatgggatac
ggtaacccccgcacattgtccgatgcctctatgcgaaactgcctgggcgacatcaaggag
ttcaagccgaccgttttggtcggtgttccggccgtgtgggagtcagtgaagaagggtgtt
ttggccaacctcaataaggctagcttcgtggtcaagagtctgttctggggtgccatgtcg
gccaagagtttcctcctgagtactggcttccctggcgcaaacctgggcgcctcggttttg
gatgccgttgtcttcaaaaagctaaaggaagcaaccggaggcaaactccgtgttgtcatg
aacggtggtggccctgtctccaaggacacccagaggttcttgtcaatggctattgccccc
atgattagcggatacggtctaaccgagacctctgccatgggtgccctgaacgaccccttg
gcctggaaccccgatgctctgggtgaggttcctgcctcgatcgaagtcaagcttgttgac
ttccctgatgctggataccttacctcgaacaaccctcctcagggtgagattttcatccgc
ggcggcagtgtgacgtcaggctactacgacaatgaggaggagaccaaggccgcaatcact
gaggatggctggttcatgaccggtgatattggcgaattcgatcccaatggccatctgaaa
atcgttgaccgcaagaagaaccttgtcaagaccttgaacggtgaatacatcgcgttggaa
aagctcgagtctgtctaccgctcgtctcccgtgattggtaacatctgtgtctacgctgcc
gaggaccaagacaagcccgtcgccatcattgttcccgccgagccggcactgaagaagctt
gcccatgagaatggcattgagggtgacaccctcgagagccttgtccacgacgaaaagctc
aacaagatcgtcttgcaacagctgcaggccactggtcgtgctggtggcttgagaggaatt
gagattataaatggtgtcgtgctatctgacgacgagtggaccccgcagaacgggttcatg
accgctgcgcaaaagctccagcgcaagaagatcctcgcccgctacgagtccaaaatcagc
atggcttacggcaagaaataa

DBGET integrated database retrieval system