KEGG   Penicillium digitatum: PDIP_67650Help
Entry
PDIP_67650        CDS       T04849                                 

Definition
(RefSeq) Extracellular invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pdp  Penicillium digitatum
Pathway
pdp00052  Galactose metabolism
pdp00500  Starch and sucrose metabolism
pdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PDIP_67650
   00500 Starch and sucrose metabolism
    PDIP_67650
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PDIP_67650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N Baculo_E56
Motif
Other DBs
NCBI-GeneID: 26235081
NCBI-ProteinID: XP_014530922
UniProt: K9G0Q3
Position
Unknown
AA seq 621 aa AA seqDB search
MKLSSAITVGLANQALAAHSDNPSVDYNSAPPNLSTLANATLFDTWRPRAHLLPPSGRIG
DPCAHYTDPKSGLFHVGWLHDGIAGATTDDLATYKDLNPDGAPVIIAGGKNDPLAVFDGS
VIPSGVNGLPTLLYTSVSYLPIHWSVPYTRGSETQSLAISSDGGRNFTKANQGPVIPTPP
FALNVTGFRDPYVFQSSILDKSVNSTEGSWYVAISGGVHNVGPCQFLYRQYDADFEYWEY
LGQWWNEPANTTWGTGDWAGGWGFNFEVGNVFGLNAEGYSEDGEIFMSLGTEGSGLPIIP
QVSPIHDMLWVTGNVTNDDSVAFKPTMAGVLDWGLSAYAAAGKILPASSQASKKSGAPDR
FISYIWLTGDLFQTVEGFPSAQQDWTGALLLPRELNIRTIPNVVDNKLSRESFASWRVAR
EESGELELETLGISIARETYSALTSGSSFVESGKTLSKAGSVPFNTSPSNKFYALTANIS
FPASARDSGLQAGFQVLSSSLESTTIYYQFSNESIIIDRSKTSAASKTTDGILSDNEAGR
LRLFDVLRNGTEQIENLELTIVVDNGILEVYANGRFTLGTWARSWYANSTEINFFHNGVG
EVTFDDVTVFEGLYDAWPERK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctcaagtgcaatcaccgtgggcctggcaaaccaggcattggctgctcattcc
gataacccctcggttgactacaactcggctccgccaaacctttctaccttggcaaatgca
acccttttcgacacatggagacccagagcccacctcctgcctccctctgggaggataggc
gacccgtgcgcgcactacaccgatcctaagtccggtctcttccatgtgggttggcttcac
gatggaattgcaggagccacgacggatgatcttgctacctataaagatctcaatcctgat
ggagctccggtaatcatcgctggaggaaagaatgatccccttgccgtcttcgatggctcc
gtcattccaagcggtgtcaatggcctgccaaccctgttgtatacctctgtttcgtacctc
ccaattcactggtctgtcccttacaccaggggaagcgagacacaatcactggctatttcg
tccgacggtggacgcaacttcaccaaggctaatcaaggccctgtgatccccacgcctcca
tttgctctcaatgtcaccggtttccgtgacccctacgttttccagagctcaattctagac
aaatctgtcaacagcaccgagggaagctggtatgtcgccatctctggcggtgtccacaat
gtcggcccttgccagtttctctaccgtcagtatgacgcagatttcgaatactgggagtat
ctcggccaatggtggaatgagcccgccaataccacttggggtaccggtgactgggctggc
ggatggggcttcaactttgaggttggcaacgtcttcggtctgaatgcagagggctacagt
gaggatggtgaaatcttcatgtcccttggtactgagggctcagggctccccatcattccc
caggtctctccaattcacgacatgctgtgggtgaccggaaatgtcacaaacgacgactcc
gtcgcattcaagccaaccatggccggtgtacttgactggggcttgtcggcgtatgctgct
gcaggcaagattttgccagctagctctcaggcatccaagaagagcggtgcccccgatcgt
ttcatttcatacatctggctcaccggagatctgttccagacggtggagggattccctagc
gcccagcaagactggaccggggctctcttgctgccacgcgaactgaatattcgcactatc
cccaacgtggtggataacaaactttcgcgcgagtccttcgcatcgtggcgcgtggcccgc
gaagaatccggtgaactcgagcttgagacactgggaatctcaattgccagggagacctac
agtgctctcacatccggctcatcgtttgtcgagtctggtaaaactttgtccaaggctggg
tcggtgccgttcaacacctcaccctcaaacaagttctacgctctgacagccaacatctct
ttcccggcctccgctcgtgactccggactgcaagctggtttccaagtgctgtcctctagt
cttgagtctacaactatctactaccaattctccaacgagtccatcatcatcgaccgcagc
aaaacgagtgccgcatcgaaaacaactgatggaattctcagtgataacgaggcgggccgt
cttcgtctctttgacgtcttaagaaatggaacagaacaaatcgaaaacttggagcttacc
atcgtggtggacaacggaatcctagaagtctatgctaatggacgctttactctgggcact
tgggctcggtcttggtacgccaactcgactgaaattaacttcttccataacggtgtggga
gaggtgacatttgacgatgttactgtctttgagggactttatgacgcctggccagagagg
aagtaa

DBGET integrated database retrieval system