KEGG   Penicillium digitatum: PDIP_76680Help
Entry
PDIP_76680        CDS       T04849                                 

Definition
(RefSeq) Alternative NADH-dehydrogenase
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
pdp  Penicillium digitatum
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PDIP_76680
Enzymes [BR:pdp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     PDIP_76680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 26235984
NCBI-ProteinID: XP_014531825
UniProt: K9G0D6
Position
Unknown
AA seq 567 aa AA seqDB search
MAPSIMQLSSMTRRSMSTSQVLRAKPMRSTKISQSVSRIARRGYADAAPSPTLKPKKRFR
ALRWAWRLTWLSAIGLTGTVAYSIFDLRQPPDQAPPDPSKKTLVILGTGWGSVSLLKKLD
TENYNVIVVSPRNYFLFTPLLPSCTTGLIEHRSIMEPIRNILRHKKASVQFYEAEATKID
YEKRVVYISDDSEIKGDISHTEVPFDMLVIGVGAENATFGIPGVRENSCFLKEVGDAQNI
RKRIMDCIETACFKDQTEDEVKRLLHMVVVGGGPTGVEFAGELKDFFNDDLKKWIPEIKD
NFHVTLVEALPNVLPMFSKQLIEYTESTFKEEEISIRTKTMVKKVTDKYIQAEVTKPDGS
KELETIPYGLLVWATGNAIRGVVRDLMSQIPAQAESRRGLAVNEYLVVNGTENVWAVGDC
AIANYAPTAQVASQEGAFLGRLFNTMAKAEALEQELEILSDRQSQAKGDEERNQIFDEIR
ERQKQLRRNKQIGPFQYSHQGSLAYIGKERAVADISWLSGNIASGGTMTYLFWRSAYLSM
CFSTRNRVLVCVDWVKARLFGRDVSRE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtccatcatgcagctgtcgtcgatgacgcgtaggtcgatgtcgacatcgcag
gtccttcgcgcgaagccgatgcggtcgaccaagatttcccagtccgtgtcgcgtatcgct
cgccgtggctacgcggatgctgctccttcgcccaccctgaagccgaagaagcgtttcaga
gctctgcgttgggcctggcggttgacctggctctctgccattggtctgaccggtactgtc
gcatacagcattttcgatctccgtcaacccccggatcaagccccgcctgacccatcgaag
aagactttagtcattctcggaactggctggggttctgtttccctcctgaagaagcttgac
acggagaactacaatgttatcgtcgtctccccccgtaactacttcctgttcactcccttg
ctgccctcttgtaccaccggtttgatcgagcaccgctcgatcatggagcctatccgaaat
atcctgcgccacaagaaggctagtgtccagttctatgaagccgaggccaccaagatcgac
tatgagaagcgggttgtttatatcagtgatgattcggaaattaagggtgacatctcgcac
accgaggttccctttgacatgcttgtgatcggtgttggtgccgagaacgcgacttttggt
attcccggtgttcgtgagaactcctgcttcctgaaggaagtcggtgacgctcagaacatt
cgtaagcgcattatggactgtatcgagactgcctgtttcaaggatcagaccgaggacgag
gtcaagcgtctgctgcacatggttgtggtgggcggtggccccactggtgttgaattcgcc
ggtgaactcaaggacttcttcaacgatgacctgaagaaatggattcccgaaatcaaggac
aacttccacgttactctcgtcgaggctctccccaacgttctgcccatgttctcaaagcaa
ctgattgaatacaccgaatcgacctttaaggaggaggagatctccatccgcaccaagacc
atggtcaagaaggttaccgacaagtacattcaagccgaggtgaccaagcccgacggatcc
aaggagcttgagaccatcccctacggtcttctcgtctgggccaccggtaacgccatccgc
ggcgtcgtacgcgacctcatgtcccagatccccgctcaggccgagtcccgccgcggtctc
gctgtcaatgaataccttgtcgtaaacggtaccgagaacgtctgggctgttggcgactgc
gccattgccaactacgccccgaccgcccaagttgctagccaggagggtgccttcttgggc
cgcctctttaacaccatggccaaggccgaggctctcgagcaggagctagagatcctctca
gaccgtcagtcccaggccaagggcgacgaggagcgtaaccagattttcgatgagatccgc
gagcgccagaagcagctccgccgcaacaagcagattggtcccttccagtactcgcaccag
ggttccttggcttacatcggcaaggagcgtgccgtggccgatattagctggctgagcggc
aacatcgccagcggcggtactatgacctacctgttctggcgcagtgcctacctgagcatg
tgcttcagcactcgcaaccgtgtccttgtctgcgttgactgggtcaaggctcgtctcttc
ggtcgtgatgtctcccgggagtaa

DBGET integrated database retrieval system