KEGG   Polynucleobacter duraquae: CL55_00000550Help
Entry
CL55_00000550     CDS       T04207                                 

Definition
(GenBank) ribosomal protein L22, bacterial type
  KO
K02890  large subunit ribosomal protein L22
Organism
pdq  Polynucleobacter duraquae
Pathway
pdq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pdq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CL55_00000550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pdq03011]
    CL55_00000550
Ribosome [BR:pdq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CL55_00000550
  Bacteria
    CL55_00000550
  Archaea
    CL55_00000550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: AKD24388
UniProt: A0A0E3V083
Position
59140..59469
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHKGARISAQKTRLVADQIRGLPIARALNILNFSPKKAAFIVKKVVESAMANAEH
NKGADIDELKVSTIIVDKGTSLKRFTARAKGRGNQIEKQTCHITVTLSN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagttaaagctattcacaaaggcgcccgcatttctgcgcaaaagacacgtttggtc
gctgaccagatccgtggtttgccaattgcacgcgcattgaacattttgaatttcagcccc
aagaaagctgccttcattgtgaagaaagttgttgagtccgcaatggccaacgctgaacac
aataagggtgctgatattgatgagctcaaggtttcaacaattattgttgataagggtact
tccttgaagcgcttcacagcacgcgctaagggtcgtggtaatcaaatcgaaaaacaaaca
tgtcacatcaccgtgaccttgagtaactaa

DBGET integrated database retrieval system