KEGG   Polynucleobacter duraquae: CL55_00010330Help
Entry
CL55_00010330     CDS       T04207                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdq  Polynucleobacter duraquae
Pathway
pdq00071  Fatty acid degradation
pdq00072  Synthesis and degradation of ketone bodies
pdq00280  Valine, leucine and isoleucine degradation
pdq00310  Lysine degradation
pdq00362  Benzoate degradation
pdq00380  Tryptophan metabolism
pdq00620  Pyruvate metabolism
pdq00630  Glyoxylate and dicarboxylate metabolism
pdq00640  Propanoate metabolism
pdq00650  Butanoate metabolism
pdq00900  Terpenoid backbone biosynthesis
pdq01100  Metabolic pathways
pdq01110  Biosynthesis of secondary metabolites
pdq01120  Microbial metabolism in diverse environments
pdq01130  Biosynthesis of antibiotics
pdq01200  Carbon metabolism
pdq01212  Fatty acid metabolism
pdq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CL55_00010330
   00630 Glyoxylate and dicarboxylate metabolism
    CL55_00010330
   00640 Propanoate metabolism
    CL55_00010330
   00650 Butanoate metabolism
    CL55_00010330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CL55_00010330
   00072 Synthesis and degradation of ketone bodies
    CL55_00010330
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CL55_00010330
   00310 Lysine degradation
    CL55_00010330
   00380 Tryptophan metabolism
    CL55_00010330
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CL55_00010330
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CL55_00010330
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CL55_00010330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdq04147]
    CL55_00010330
Enzymes [BR:pdq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CL55_00010330
Exosome [BR:pdq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CL55_00010330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKD25366
UniProt: A0A0E3ZLF5
Position
997835..999019
Genome map
AA seq 394 aa AA seqDB search
MSRDVVVLSAVRSAIGAFNGSLSSLEPSELGGIVMKEAVARSGVDPALINYITVGNTIPT
DNRYAYVARVASIQAGLPMESVAMALNRLCSSGLQAIVTTAQAIMLGDCDYGVGGGVEVM
SRGMYGSPAMRSGARMGDTKMIDLMVSVLTDPFGVGHMGVTAENLVEKWKLTREEQDALA
VESHRRAAHAIKEGRFKSQIVPITIKTRKGDVVFDTDEHCKPDTTMETLGKMKAVFKKEG
GSVTAGNASGINDGAAFFVLAEAEAAKKAGHKPIARLVSYAIAGVPNHIMGEGPIPATKI
ALERAGLKLDQIDVIESNEAFAAQALAVTKGLGLDPAKTNVNGGAIALGHPIGCSGAAIA
TKAIHELHRVQGKYALVTMCIGGGQGIATIFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgatgtcgtcgttttaagtgctgtgcgttctgcaattggcgccttcaatggt
tcgcttagcagcctagagccaagtgagctcggcggcattgtgatgaaagaggctgttgca
cgctctggagtagatccagcattaattaattacatcactgtaggcaatacgattccgact
gataaccgttatgcctatgttgctcgcgtagcttctattcaggctggtctgccaatggaa
tctgtagcgatggctttgaatcgtttatgtagctctggcttacaagcgattgtgaccaca
gcccaagccattatgttaggcgactgcgattacggcgtcggtggtggtgtcgaagtgatg
tcacgtggtatgtatggttcacccgcaatgcgaagtggtgcccgtatgggtgacaccaaa
atgatcgacttgatggtgtctgttttgactgatccatttggtgttggtcacatgggcgta
acggctgagaatttggttgaaaagtggaaactcacccgtgaagagcaagacgcccttgca
gtagagtcccatcgccgtgcagcacacgctattaaagaaggtcgctttaaatctcaaatt
gttccaatcaccatcaagactcgtaagggtgatgtggtgtttgatacggacgagcattgc
aagcctgacaccacgatggaaactttagggaagatgaaggcggtcttcaaaaaagagggt
ggcagtgttactgcaggtaatgcatccggtattaatgatggcgcagcattctttgtgctt
gctgaagcggaagcggcgaagaaggctggtcataagccaatcgctcgtttagtctcttat
gcgattgctggcgttcctaaccacattatgggtgaaggtccaatccctgcaaccaagatt
gctcttgagcgcgcaggcctgaaattagatcaaatcgatgtgattgaatctaatgaagcg
tttgctgcgcaggcattggcggttaccaaaggtttgggcttagatccagctaagaccaac
gtcaatggtggagcgattgcattgggccacccaattgggtgctctggtgctgcgattgcc
actaaagccatccatgaattacatcgggttcaaggtaaatatgctttggtcaccatgtgt
attggtggcggacaaggtattgcaactatttttgagcgcctctaa

DBGET integrated database retrieval system