KEGG   Polynucleobacter duraquae: CL55_00013410Help
Entry
CL55_00013410     CDS       T04207                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, B subunit
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
pdq  Polynucleobacter duraquae
Pathway
pdq00860  Porphyrin and chlorophyll metabolism
pdq01100  Metabolic pathways
pdq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CL55_00013410
Enzymes [BR:pdq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     CL55_00013410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKD25674
UniProt: A0A0E3V0X9
Position
complement(1303785..1305410)
Genome map
AA seq 541 aa AA seqDB search
MQLTLWTYEGPPHIGAMRIATSMTDLHYVLHSPQGDTYADLLFTMIGRAKTRPPVTYTTF
QARDLGGDTAQLFQDSVNSAYERFQPKAMIVGASCTAELIQDDPGGLARALTLPIPVIAL
ELPSYQKKENWGASETFYHIARGLVAFDKSISAQQYQEMRATNAKQDQKPSCNILGPTAL
GFRNRDDIQEIKSLLEAMGIEVKVVAPLNASVADITQLPQADFNVMLYPEIAQLTCTWLQ
KTFGQPFTKTIPIGTKATRAFVQEVAALANINPESFLQSQDERAHWYAKSVDSTYLTDKR
VFIFGDASHVIAAAKVASEEIGFKVVGLGTYSREFAREVREAAKLYEVEALITDDYLEVE
EKVAELTPDLVLGTQMERHIAKRLGIPCAVISAPVHVQDFPARYSPQMGFEGANVLFDTW
IHPLMMGLEEHLIMMFRDDFEFSAKAAPSHLGHSSAVKENLHSSEPQSIAPVVSHTQVNA
EIFSGTEPANLWDAEAEKELGKIPFFVRGKARRNTEKFAVEHGISHITIETLYDAKAHYG
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgacactctggacatatgaaggcccaccacacattggtgcaatgcgcattgct
acctcgatgaccgatttgcattatgtcttgcattcgccacagggtgatacatacgctgat
ctcttgtttacgatgattggtcgcgctaaaacccgtcctccagtcacctatacgacattt
caggcaagagacttaggcggggatacagcgcagttattccaggattctgtcaattctgca
tatgaacgtttccagcctaaggcgatgatcgtaggcgcttcctgtactgcagaattaatt
caggacgatccaggtggcttggcaagagcactcactttaccgattcctgtgattgcactc
gaacttccttcgtatcagaaaaaagaaaactggggcgcttcagaaactttttatcatatt
gctcgtggattagtggcattcgataaatccattagtgcccagcagtatcaagagatgcgg
gcaactaatgcaaaacaagatcaaaagcctagttgcaatattctcggacccactgcctta
ggatttagaaatcgcgacgacattcaagaaattaagtctctattagaggcgatgggcatt
gaggtgaaagtagttgcacctctgaatgcttcggttgcagatatcacccaattacctcag
gcagactttaatgtcatgctgtatccagaaattgctcagctgacttgtacatggctgcag
aagacatttggacagcctttcacaaagacaattccgattggtacgaaagctacgagagcc
tttgttcaagaagtcgccgcattagcgaatatcaatccggagtcttttttacagtctcaa
gatgaacgggctcattggtacgcaaaatcggtcgattctacttatctaaccgataagcgt
gtatttatatttggcgatgcaagtcatgtcattgctgctgccaaagtcgcatcagaagaa
attggctttaaggtagttggcttaggaacttacagccgcgaatttgcccgcgaagtccgt
gaagctgcaaagctctatgaagtagaagctttaattaccgatgactatttagaagttgag
gaaaaagttgctgagctcaccccagacttagttttgggtacacaaatggaacgccatatc
gctaaacgattaggcattccttgtgctgtgatttctgcgccagtccatgttcaggacttt
ccagcacgctactcaccacagatgggatttgagggtgctaatgtattgtttgacacctgg
attcatccactcatgatgggtcttgaagagcacctgattatgatgttccgcgatgatttt
gaatttagtgctaaggcagcaccttctcatctaggtcattcatcagctgttaaagagaat
ctacactcatcagagccacaatcaatcgctccagtagtcagccacacacaggtaaatgct
gaaatatttagcggtacagagccagcgaatttatgggatgcagaagcagaaaaagaattg
ggaaagattccattctttgttagaggcaaagcacgacgcaataccgagaagttcgcagtt
gagcatggcattagccatatcactattgaaacgctctacgatgcaaaggctcactatggc
agataa

DBGET integrated database retrieval system