KEGG   Polynucleobacter duraquae: CL55_00017000Help
Entry
CL55_00017000     CDS       T04207                                 

Definition
(GenBank) Geranylgeranyl pyrophosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
pdq  Polynucleobacter duraquae
Pathway
pdq00900  Terpenoid backbone biosynthesis
pdq01100  Metabolic pathways
pdq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CL55_00017000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pdq01006]
    CL55_00017000
Enzymes [BR:pdq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CL55_00017000
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CL55_00017000
Prenyltransferases [BR:pdq01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CL55_00017000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AKD26033
UniProt: A0A0E3V242
Position
complement(1654276..1655178)
Genome map
AA seq 300 aa AA seqDB search
MNHALSFEDWVRAHGQRTELVLESLLDAANANPVRLHAAMRYAAQGGGKRIRPLLVYAAG
ELGDDSGEEKNNALDSAAFAIECIHAYSLVHDDLPCMDDDDLRRGRPTVHKAYDEATALL
VGDALQTRAFEVLANTQCDGNTRLAMISALASASGSRGMAGGQAIDLESVGKKLDLTGLK
QMHAMKTGALLSCSVQMGGIAAKLNAIQMQHLKNYSEALGLAFQIVDDVLDVTADSQTLG
KTAGKDAANDKPTYVTLMGLDYAKKAATDLQETAIASLESFGAKAQALKDLALLVVNRGK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgcactttcatttgaagattgggttcgtgctcacgggcagcgaactgaattg
gttctcgagagtttgctcgatgctgcaaatgctaatcctgtacgtttgcacgcagccatg
cgttacgccgctcaaggtggcggtaagcgtattcgtcctttattggtttatgccgctggt
gagctaggtgatgattccggtgaagagaaaaataacgctctagattctgctgcgtttgca
attgaatgtattcacgcctactctttggtccacgatgatttgccttgtatggatgacgat
gatttacgccgtggacgtcctactgtacataaggcttatgacgaggcgactgctttattg
gttggcgatgcattacagactcgtgcatttgaggttttggcaaatacgcagtgcgatggg
aatacgcgcttggcaatgatcagtgcattggctagtgcgtctggttcgcgcggtatggct
ggtggtcaggcaattgatttggagagtgtgggtaaaaaattagatctcacaggcttaaaa
caaatgcatgcgatgaaaacaggtgctctactttcttgttctgtgcagatgggcggcatt
gctgccaagctcaatgcgattcaaatgcagcatctcaaaaactactctgaagctttaggc
ctagcctttcaaattgtggatgatgttttggatgtcaccgcagatagtcaaactttgggt
aaaaccgcaggaaaagacgcagccaacgacaagcccacctatgtgaccttgatgggttta
gactatgccaagaaagcggcaaccgatttacaagaaacggcaattgccagcttagagagt
tttggcgctaaagctcaagccctgaaagatttggctctattagtggttaatagaggtaaa
taa

DBGET integrated database retrieval system