KEGG   Pseudomonas sp. ATCC 13867: H681_01240Help
Entry
H681_01240        CDS       T02524                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00250  Alanine, aspartate and glutamate metabolism
pdr00310  Lysine degradation
pdr00650  Butanoate metabolism
pdr01100  Metabolic pathways
pdr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    H681_01240
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H681_01240
   00310 Lysine degradation
    H681_01240
Enzymes [BR:pdr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     H681_01240
    2.6.1.48  5-aminovalerate transaminase
     H681_01240
Amino acid related enzymes [BR:pdr01007]
 Aminotransferase (transaminase)
  Class III
   H681_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGI22130
UniProt: M4X9T8
Position
277483..278763
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLLQRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKLTHTCFQVLAYEPYIELAEEIAKRVPGNFPKKTLLVTSGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVS
EDESIASIERIFKNDAQPRDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDEHGILLIAD
EVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVSGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVLKVFDEEKLLERSQAVGERLKAGLRDIQAKHKVIGDVRGLGSMVAIEL
FEGGDHNKPAAELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaccaacgaatccctgctgcaacgtcgtcaggccgccgtaccgcgcggtgta
ggccagatccacccggtcgtcgccgagcgcgccgagaactccaccgtgtgggacgtcgaa
ggtcgcgagtacatcgacttcgccggcggcatcgccgtactgaacaccggccacctgcac
ccgaaagtggttgccgccgttcaggagcaactgaccaagctgacccacacctgcttccag
gtgctggcgtacgagccctacatcgaactggccgaagagatcgccaagcgcgttccgggc
aacttcccgaagaagaccctgctggtcacctccggctccgaagccgttgaaaacgccgtc
aagatcgcccgtgccgccactggccgcgctggcgtgatcgccttcaccggcgcctaccac
ggccgtaccatgatgaccctgggcctcaccggcaaggtcgttccgtactccgctggcatg
ggcctgatgccgggcggcatcttccgcgctctggctccgtgcgaactgcacggcgtgagc
gaagacgagtcgatcgccagcatcgagcgcatcttcaagaacgacgcccagccgcgcgac
atcgctgccatcatcatcgagccggttcagggcgaaggtggcttctacgtcaactccaag
tccttcatgcagcgcctgcgcgccctgtgcgacgagcatggcatcctgctgatcgctgac
gaagtacagaccggcgctggccgtaccggcaccttcttcgccaccgagcaactgggcatc
gttccggacctgaccaccttcgccaagtccgttggcggcggtttcccgatctccggcgtt
tccggcaaggccgaaatcatggacgccatcgctcccggcggcctgggcggcacctacgcc
ggtagcccgatcgcctgcgccgcggccctggccgtgctgaaagtgttcgacgaagagaag
ctgctggagcgttcgcaagccgttggcgagcgcctgaaggctggtctgcgcgacatccag
gccaagcacaaggtgatcggcgacgttcgtggcctgggttcgatggttgccatcgagctg
ttcgaaggcggcgaccacaacaagccggctgccgaactggtcagcaagatcgtggttcgc
gcccgtgagaaaggtctgatcctgctctcctgcggcacctactacaacgtgatccgcttc
ctgatgccggtaaccatccctgacgcgcagctggaaaaaggcctggccatcctggccgag
tgcttcgacgaactggcctga

DBGET integrated database retrieval system