KEGG   Pseudomonas sp. ATCC 13867: H681_02485Help
Entry
H681_02485        CDS       T02524                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pdr  Pseudomonas sp. ATCC 13867
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    H681_02485 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 CARDB Chitin_bind_4 DUF4352
Motif
Other DBs
NCBI-ProteinID: AGI22379
UniProt: M4WRP8
Position
complement(548411..548791)
Genome map
AA seq 126 aa AA seqDB search
MSDPRYNVTVSVTTRHLPEQSQPEQQRYVFAYTVTIHNQGEQAAKLLTRHWVITDGNGHV
QEVRGAGVVGEKPLIEPGASHTYTSGTVLATQVGSMHGSYQMIATDGHHFDAEIPVFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccgcgctacaacgtcaccgtcagcgtcactacccgccacctgccggaacag
tcccagccggagcagcagcgctacgtattcgcctacaccgtgaccatccacaaccagggc
gaacaggccgccaagctgctcactcgccactgggtcatcaccgacggcaacggccatgtg
caggaagtgcgcggcgccggggtggttggcgagaaaccgctgatcgagccgggcgccagc
catacctacaccagcggcaccgtactggccacgcaggtgggcagcatgcacggcagctac
cagatgatcgccaccgacggccaccatttcgacgccgagatcccggtgttccgcctggcc
gtgccgggggccctgcactga

DBGET integrated database retrieval system