KEGG   Pseudomonas sp. ATCC 13867: H681_04110Help
Entry
H681_04110        CDS       T02524                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00640  Propanoate metabolism
pdr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    H681_04110
Enzymes [BR:pdr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     H681_04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C TetR_C_3
Motif
Other DBs
NCBI-ProteinID: AGI22704
UniProt: M4WSJ3
Position
complement(887915..890524)
Genome map
AA seq 869 aa AA seqDB search
MNTQFRKRLPGTALDYFDAREAVDAIQAGAWDKLPYTSRVLAEQLVRRCDPQDLTASLEQ
LVYRKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPSKVNPVVPTQLIVDH
SLAVEAAGFDPDAFEKNRAIEDRRNEDRFHFIDWTKTAFKNVDVIPAGNGIMHQINLEKM
SPVVQARGGVAFPDTCVGTDSHTPHVDALGVIAIGVGGLEAETVMLGHPSMMRLPDIVGV
KLTGKRKPGITATDIVLAITEFLRKERVVGAYVEFFGEGADSLTIGDRATISNMCPEYGA
TASMFYIDGQTIDYLKLTGREPEQVALVENYAKTLGLWSTALETAEYERVLEFDLGSVVR
NMAGPSNPHRRLPTSALAERGIADEAKLQAGKGEEAQGLMPDGAVIIAAITSCTNTSNPR
NVIAAGLVAKKANALGMIRKPWVKTSFAPGSKVAKLYLEEAGLLPELEKLGFGIVAYACT
TCNGMSGALDPVIQKEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAG
TVRFDIEQDPLGTDKNGNPVTLKDLWPSDEEIDAIVAASVKPEQFKQVYIPMFDLGSVQE
AESPLYDWRPMSTYIRRPPYWEGALAGERTLKGMRPLAILPDNITTDHLSPSNAILADSA
AGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPQLVNEMAVVNGEVKKGSLARVEPE
GKVMRMWEAIETYMNRKQNLIIVAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHRT
NLVGMGVLPVEFKPGTTRLTLGLDGTETYDIKGDVSPRCDLTLVVNRRNGEVVEVPVTCR
LDTAAEVKVYNAGGVLQRFAKDFLESSVA
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcaattccgcaaacgcctgcccggcaccgcactggattacttcgacgcccgc
gaggccgtcgacgcgatccaggccggcgcctgggacaaactcccctacacctcccgcgtg
ctggccgaacagctggtgcgccgctgcgatccgcaggacctgaccgcctccctggagcag
ttggtctaccgcaagcgcgacctggacttcccctggtacccggcgcgcgtggtctgccac
gacatcctcggccagaccgcgctggtcgacctggccggcctgcgtgacgccatcgcagag
aaaggcggcgacccgtccaaggtcaacccggtggtgccgacccagttgatcgtcgaccac
tcgctggccgtggaagccgcgggcttcgacccggatgccttcgagaagaaccgcgccatc
gaggaccgccgcaacgaggatcgcttccacttcatcgactggaccaagaccgcgttcaag
aacgtcgacgtgatcccggccggcaacggcatcatgcaccagatcaacctggagaaaatg
agcccggtggtccaggcgcgcggtggcgtggccttccccgacacctgcgtcggcaccgac
tcgcacaccccgcacgtggacgccctgggcgtgatcgccatcggcgtcggtggcctcgaa
gccgagaccgtgatgctgggccacccgtcgatgatgcgcctgcccgacatcgtcggcgtc
aagctcaccggcaagcgcaagccgggcatcaccgccaccgacatcgtcctggcgatcacc
gagttcctgcgcaaggagcgcgtggtcggcgcctacgtcgagttcttcggcgaaggggcg
gacagcctgaccatcggcgaccgcgcgaccatctccaacatgtgcccggaatacggcgcc
accgcctcgatgttctacatcgacggccagaccatcgactacctcaagctcaccggccgc
gagcccgagcaggtggcgctggtggaaaactacgccaagaccctcggcctctggagcacc
gctctggaaaccgccgagtacgagcgcgtgctggagttcgacctgggcagcgtcgtgcgc
aacatggccggcccgtccaacccgcaccgccgcctgccgacctcggcgctggccgagcgc
ggcatcgccgacgaagccaagctgcaagccggcaagggtgaagaagcccagggcctgatg
cccgacggcgcggtgatcatcgccgccatcaccagctgcaccaacacttccaacccgcgt
aacgtcatcgccgccggcctggtggcgaagaaggccaacgcgctgggcatgatccgcaag
ccgtgggtgaagacctccttcgcgccgggttcgaaagtcgccaagctgtacctggaagaa
gccggcctgctgccggagctggagaagctcggcttcggcatcgtcgcctatgcctgcacc
acttgtaacggcatgtccggcgcgctggacccggtgatccagaaagagatcatcgaccgc
gacctgtacgccaccgccgtgctctcgggcaaccgcaacttcgacgggcgcatccacccc
tacgccaagcaggccttcctcgcctcgccgccgctggtggtcgcctacgccatcgccggc
accgtgcgcttcgacatcgagcaggacccgctgggcaccgacaagaacggcaacccggtc
accctgaaggacctctggccgtccgacgaggagatcgacgccatcgtcgccgccagcgtc
aagcccgagcagttcaagcaggtctacatcccgatgttcgacctgggcagtgtgcaggaa
gcggaaagcccgttgtacgactggcgcccgatgtccacctacatccgccgtccgccgtac
tgggaaggcgcactcgcgggcgagcgcacgctgaaaggcatgcgtccgctggcaatcctg
ccggacaacatcaccaccgatcacctgtcgccgtccaacgccatcctggcggactcggcc
gccggtgagtacctggcgaaaatgggcctgccggaggaggacttcaactcctacgccacc
caccgcggcgaccacctgaccgcccagcgcgccaccttcgccaacccgcagctggtcaac
gaaatggccgtggtcaacggtgaggtgaagaagggttcgctggcccgcgtcgagccggaa
ggcaaggtgatgcgcatgtgggaagccatcgaaacctacatgaaccgcaagcagaacctg
atcatcgtggccggcgccgactacggccagggctcgtcccgcgactgggcggccaagggc
gttcgcctggcgggcgtggaagtgatcgtggccgaaggcttcgagcgcatccaccgcacc
aacctggtgggcatgggcgtgctgccggtggagttcaagccgggcaccacccgcctgacc
ctgggcctggacggcaccgagacctacgacatcaagggcgacgtctcgccgcgctgcgac
ctgaccctggtggtcaatcgccgcaatggtgaagtggtcgaagttccggtcacctgccgc
ctggacaccgccgccgaagtgaaggtgtacaacgccggcggcgtgctgcagcgcttcgcc
aaggacttcctcgagtcgtccgtggcgtga

DBGET integrated database retrieval system