KEGG   Pseudomonas sp. ATCC 13867: H681_10270Help
Entry
H681_10270        CDS       T02524                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00790  Folate biosynthesis
pdr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H681_10270 (folE)
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     H681_10270 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI MAPKK1_Int
Motif
Other DBs
NCBI-ProteinID: AGI23928
UniProt: M4WUW7
Position
complement(2246982..2247527)
Genome map
AA seq 181 aa AA seqDB search
MSLEQHYSAILSQLGEDVTREGLVDTPKRAAKAMQYLCRGYQQTLEEIVNGALFSSDNSE
MVLVKDIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENMSRQ
IAEAVQQVTGALGVAVVIEAKHMCMMMRGVEKQNSSMVTSVMLGEFRENAATRSEFLSLI
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacaacactactccgcgatcctcagccaactcggtgaggacgttacccgt
gaaggcctggtcgatacgcccaagcgtgccgccaaagccatgcagtacctttgccgcggc
taccagcagacgctggaggagatcgtcaacggcgcgctgttcagctccgacaacagcgaa
atggtgctggtcaaggacatcgagctctactcgctctgcgagcaccacctgctgcccttc
atcggcaaggcccacgtcgcctacattcccaacggcaaggtgctggggctgtcgaaggtc
gcgcgcatcgtcgacatgtacgcccgccgcctgcagatccaggaaaacatgtcgcggcag
atcgccgaggccgtgcagcaggtcaccggcgcgctgggcgtggccgtggtgatcgaggcc
aagcacatgtgcatgatgatgcgcggcgtggagaagcagaactcctcgatggtcacctcg
gtgatgctcggcgagttccgcgagaacgccgccacccgcagcgagttcctcagcctgatc
cgctga

DBGET integrated database retrieval system