KEGG   Pseudomonas sp. ATCC 13867: H681_15375Help
Entry
H681_15375        CDS       T02524                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00310  Lysine degradation
pdr01100  Metabolic pathways
pdr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    H681_15375
Enzymes [BR:pdr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     H681_15375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_2 Mqo Amino_oxidase HI0933_like FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGI24943
UniProt: M4WXQ8
Position
3470152..3471345
Genome map
AA seq 397 aa AA seqDB search
MTYDFCIIGGGIVGLATAMRLLQVRPGASLLLLEKEDSLARHQTGHNSGVIHAGIYYAPG
SLKADLCKRGAQATQDFCDEHGIAYDVCGKLLVASSALELQRMDALLERSKLNGLDVKRV
EAGELREREPNIVGLGGLFLSSTGIVDYRQVCQAMAKVIERSGGEVRLGVKVDAIREGGD
NVHIRAGDEGWTARQLVACAGLQSDRLARLAGIETQHQIIPFRGEYYRLPASKNDIVKHL
IYPIPDPELPFLGIHLTRMIDGSVTVGPNAVLGFAREGYPKFSTHLADVLEYARFPGFWK
TIGANLRSGLAEMKNSLFKAGYLEQCRKYCPSLQLDDLQPIEAGIRAQAVMRDGTLVHDF
LFLETPRMLHVCNAPSPAATSAIPIGEMIADRLLQQA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgacttctgcatcatcggtggcggcatcgtcggcctggccacggccatgcgc
ctgctgcaggtgcgccccggtgcgtcgctgctcctgctggaaaaggaagacagcctggcc
cgccaccagaccggccacaacagcggcgtgatccacgccggcatctactacgcgccgggc
agcctgaaggcagacctgtgcaagcgtggcgcccaggccacccaggacttctgcgacgag
cacggcatcgcctacgacgtctgcggcaagctgctggtggcgtccagcgccctcgaactg
caacgcatggacgccctgctggagcgctcgaagctcaacggcctggacgtcaagcgcgtg
gaggccggcgaattgcgcgagcgcgagccgaacatcgtcggcctcggcggcctgttcctc
tcctccaccggcatcgtcgactaccgccaggtctgccaggcgatggcgaaagtcatcgaa
cgcagcggtggcgaagtccgcctgggcgtgaaggtcgatgcgatccgcgagggcggcgac
aacgtccacatccgtgctggcgacgaaggctggacggcacggcaactggtggcctgcgcc
ggcctgcagtccgaccgcctggcgcgcctggcgggcatcgaaacgcagcatcagatcatt
ccgttccgcggcgagtactaccgcctgccggcgagcaagaacgacatcgtcaagcacctg
atctacccgatcccggacccggaactgccgttcctcggcatccacctgacgcggatgatc
gatggcagcgtcaccgtcggccccaacgcggtgctcggtttcgcccgcgagggttatccg
aagttctccacgcacctcgccgacgtactggagtacgcgcgcttccccggcttctggaaa
accatcggcgccaacctgcgctcgggcctggcagagatgaagaactcgctgttcaaggcc
ggttacctggagcaatgccgcaagtactgcccgtccctgcaactggacgacctgcaaccc
atcgaggccggcatccgtgcccaggcggtgatgcgcgacggcacgctggtgcatgatttc
ctgttcctcgaaacgccgcgcatgttgcacgtctgcaacgcgccctcgccggccgccacc
tcggccatccccatcggcgaaatgatcgccgaccgcctgctgcaacaggcctga

DBGET integrated database retrieval system