KEGG   Pseudomonas sp. ATCC 13867: H681_17975Help
Entry
H681_17975        CDS       T02524                                 

Definition
(GenBank) phosphoglycerate/bisphosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00860  Porphyrin and chlorophyll metabolism
pdr01100  Metabolic pathways
Module
pdr_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H681_17975
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     H681_17975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGI25462
UniProt: M4X346
Position
complement(4041193..4041783)
Genome map
AA seq 196 aa AA seqDB search
MTLFLDLLRHGETEQGGGFRGRLDDALTETGWAQMRATVGEACRWSAVVSSPLRRCAAFA
QELAGRHGLPLSLDADLRELDFGQWEGLSPAKLMESDAQALGRFWSDPYAFPPPDGEPLG
DFELRVFRALERLHRDHAGACVLVVTHGGVMRLLGALAGGLPARRLLEVVVDHGQCLSLA
VAREGEGWRIQQAERR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgttcctggacctgctgcgccacggcgaaaccgagcagggcggcggctttcgc
gggcgcctggacgatgcgctgactgaaaccggttgggcacagatgcgggcgacggttggc
gaggcgtgccgctggtcggcggtggtcagctcgccgctgcgccgctgcgccgcgttcgcg
caggaactggcgggccgccacgggctgccgctgagcctggacgccgacctgcgcgagctg
gacttcggccaatgggaaggcctttcgccagctaagctgatggaaagcgatgcccaggcg
ctggggcgtttctggtccgatccctacgcgtttcctccgcccgacggcgagccgttgggt
gacttcgaactccgcgtattccgcgcactggagcggttacaccgcgaccacgccggcgcc
tgtgtactggtggtgacccacggtggcgtgatgcgcctgctgggggcattggctggtggc
ttgccggcccggcgtttgctggaggtggtggtcgatcacggccagtgcctgtcgctggcc
gtggcgcgtgaaggcgaaggctggcgaatccagcaggcggaacggcgatga

DBGET integrated database retrieval system