KEGG   Pseudomonas sp. ATCC 13867: H681_21410Help
Entry
H681_21410        CDS       T02524                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00071  Fatty acid degradation
pdr00072  Synthesis and degradation of ketone bodies
pdr00280  Valine, leucine and isoleucine degradation
pdr00310  Lysine degradation
pdr00362  Benzoate degradation
pdr00380  Tryptophan metabolism
pdr00620  Pyruvate metabolism
pdr00630  Glyoxylate and dicarboxylate metabolism
pdr00640  Propanoate metabolism
pdr00650  Butanoate metabolism
pdr00900  Terpenoid backbone biosynthesis
pdr01100  Metabolic pathways
pdr01110  Biosynthesis of secondary metabolites
pdr01120  Microbial metabolism in diverse environments
pdr01130  Biosynthesis of antibiotics
pdr01200  Carbon metabolism
pdr01212  Fatty acid metabolism
pdr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H681_21410
   00630 Glyoxylate and dicarboxylate metabolism
    H681_21410
   00640 Propanoate metabolism
    H681_21410
   00650 Butanoate metabolism
    H681_21410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H681_21410
   00072 Synthesis and degradation of ketone bodies
    H681_21410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H681_21410
   00310 Lysine degradation
    H681_21410
   00380 Tryptophan metabolism
    H681_21410
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H681_21410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H681_21410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H681_21410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdr04147]
    H681_21410
Enzymes [BR:pdr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H681_21410
Exosome [BR:pdr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H681_21410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGI26149
UniProt: M4X220
Position
complement(4795984..4797261)
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIVGGNRIPFARSNTVYSTASNQEMLTCALDGLIERYKLHGERLGEVVAGAVL
KHSRDFNLTRECVLGTRLAPETPAYDIQQACGTGLEAAILVANKIALGQIECGIAGGVDT
TSDAPIGVNEGLRRILLEANRGKSNGEKIKSLLKIRPRHLMPHIPRNGEPRTGLSMGEHC
EQMAQTWAIPRDEQDKLAFESHHKLAAAYDEGWQNDLMTPFRGLVRDQNLRPDINLEKIG
TLKPVFERGSRGTLTAANSTPLTDGASVVLLASEEWAKERGLPILAYFKDGEAAAVDFVG
GHEGLLMAPVYAVPRLLARNGLSLQDFDFYEIHEAFAAQVLCTLKAWEDAEYCKERLGLD
APLGSIDRSKLNVKGSSLAAGHPFAATGGRIIANLAKLLDGAGKGRGLISICAAGGQGVT
AIVEK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccaattgcgccgggtcgccatcgtcggcggcaaccgtattcccttcgcccgctcc
aacaccgtgtattccacggcgagcaaccaggagatgctgacctgtgcgctggacggcctg
atcgagcgctacaagctgcacggcgagcgcctgggcgaggtggtcgccggcgcggtgctc
aagcattcgcgcgacttcaacctgacccgcgaatgcgtgctcggcacccgcctggcgccg
gaaaccccggcctacgacatccagcaggcctgcggcaccggcctggaagcggccattctc
gtcgccaacaagatcgccctggggcagatcgagtgtggcatcgccggcggcgtggacacc
acctccgacgcgcccatcggcgtcaacgaagggctgcgcaggattttgctggaggccaat
cgcggcaagtccaacggcgagaagatcaagagcctgctgaagattcgcccgcgtcacttg
atgccgcacatcccgaggaacggcgagccgcgcaccgggctgtcgatgggcgagcactgc
gagcagatggcgcagacctgggccatcccgcgcgacgagcaggacaagctggctttcgag
agccaccacaagctggccgccgcctacgacgagggctggcagaacgacctgatgacgccg
ttccgcggcctggtgcgcgaccagaacctgcgcccggacatcaacctggagaagatcggc
accctcaagccggtgttcgaacgcggctcgcgcggcacgctgacggcggccaactccacg
ccgctgaccgatggcgcctccgtggtgctgctggccagcgaggagtgggccaaggaacgc
ggcctgccgatcctggcgtacttcaaggatggcgaagcggcggcggtggatttcgtcggc
ggccacgagggcctgctgatggcgccggtctacgcagtgccgcgcctgctggcgcgtaac
ggcctgagcctgcaggacttcgatttctatgagattcacgaagccttcgccgcccaggtg
ctgtgcaccctcaaggcctgggaggacgcggagtactgcaaggagcgcctgggactggat
gcgccgctgggctccatcgaccgcagcaagctcaatgtgaagggcagctcgctggccgcc
ggtcacccgttcgcggccacgggcggacgcatcatcgccaacctggccaagctgctggat
ggcgccggcaagggacgcggattgatctcgatttgcgcggcgggcggccaaggtgtgacc
gcgatcgtagaaaagtaa

DBGET integrated database retrieval system