KEGG   Pseudomonas sp. ATCC 13867: H681_21995Help
Entry
H681_21995        CDS       T02524                                 

Definition
(GenBank) dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00010  Glycolysis / Gluconeogenesis
pdr00053  Ascorbate and aldarate metabolism
pdr00071  Fatty acid degradation
pdr00280  Valine, leucine and isoleucine degradation
pdr00310  Lysine degradation
pdr00330  Arginine and proline metabolism
pdr00340  Histidine metabolism
pdr00380  Tryptophan metabolism
pdr00410  beta-Alanine metabolism
pdr00561  Glycerolipid metabolism
pdr00620  Pyruvate metabolism
pdr00625  Chloroalkane and chloroalkene degradation
pdr00903  Limonene and pinene degradation
pdr01100  Metabolic pathways
pdr01110  Biosynthesis of secondary metabolites
pdr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H681_21995
   00053 Ascorbate and aldarate metabolism
    H681_21995
   00620 Pyruvate metabolism
    H681_21995
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H681_21995
   00561 Glycerolipid metabolism
    H681_21995
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H681_21995
   00310 Lysine degradation
    H681_21995
   00330 Arginine and proline metabolism
    H681_21995
   00340 Histidine metabolism
    H681_21995
   00380 Tryptophan metabolism
    H681_21995
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H681_21995
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    H681_21995
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H681_21995
Enzymes [BR:pdr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     H681_21995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGI26266
UniProt: M4X3W7
Position
complement(4912490..4913980)
Genome map
AA seq 496 aa AA seqDB search
MISALLESLGVDARLATAGDQVIHSPIDGSRLGAVRLESAAEVEQKIGRAAHAFDAWRKV
PAPRRGELVRLFGEELRASKAALGELVSWEAGKITQEGLGEVQEMIDICDFAVGLSRQLY
GLTIASERPGHHMRETWHPLGVVGVISAFNFPVAVWSWNTALALVCGNSVVWKPSEKTPL
TALACQALFERALSKFGDAPAHLSQVVIGDRSAGEALVDDARVALVSATGSTRMGREVGP
RVAARFGRSILELGGNNAMILAPSADLDMAVRAILFSAVGTAGQRCTTLRRLIAHRSVKD
EIVSRLKAAYARVRIGHPLEGNLVGPLIDERSFLAMQGALEQARGEGGVVFGGARQLADK
FPEAYYVSPAIAEMPEQSDVVRHETFAPILYVVPYETFDEAVALNNAVPQGLSSCIFTTD
LREAEAFLSAVGSDCGIANVNIGPSGAEIGGAFGGEKETGGGRESGSDAWKGYMRRQTNT
VNYSRELPLAQGIVFD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgatttccgcactgctcgaatccctcggcgtcgacgcccgcctggctaccgctggcgac
caggtcatccactctcccatcgacggcagccgcctgggcgcggtgcgcctggaaagtgcc
gccgaggtggagcagaagattggccgcgccgcccatgctttcgacgcctggcgcaaggtg
ccggcgccgcgtcgcggcgagctggtgcggctgttcggcgaggagctgcgggcgagcaag
gcggcccttggcgaactggtgtcctgggaggccggcaagatcacccaggaaggcctgggc
gaggtgcaggagatgatcgacatctgcgacttcgccgtcggcctgtcgcgccagctctat
ggcctgaccatcgcctccgagcgccccggccaccacatgcgcgaaacctggcacccgctg
ggcgtggtcggggtgatcagcgccttcaacttcccggtcgcggtgtggtcgtggaacacc
gcgctggcgctggtctgcggcaactcggtggtgtggaaaccctcggagaaaaccccgctc
accgcgctggcctgccaggcgctgttcgagcgtgcgctgagcaagttcggcgacgcaccg
gcgcatctcagccaggtggtgatcggcgatcgcagcgccggcgaggcgctggtggacgac
gcgcgcgtcgccctggtcagcgccaccggcagcacccgcatgggccgcgaagtcggcccg
cgcgtggcggcgcgcttcggccgcagcatcctcgagctgggcggcaacaacgcgatgatc
ctggcgcccagcgccgatctggacatggccgtgcgcgccatcctgttcagcgccgtcggc
accgccgggcagcgctgcaccaccctgcgccggctgatcgcccacaggtcggtgaaggac
gagatcgtcagccggctgaaggccgcctacgccagggtgcgcatcggtcatccgctggaa
ggcaacctggtcggcccattgatcgacgagcgcagcttcctggccatgcagggcgcgctg
gagcaggcgcgcggcgagggcggcgtggtgttcggcggcgcgcggcaactggccgacaaa
ttccccgaggcctattacgtgtcgccggccatcgccgagatgccggagcagagcgacgtg
gtgcgccacgagactttcgcgccgatcctctacgtggtgccctacgagacgttcgacgag
gcggtggcgctgaacaacgccgtgccccagggcctgtcgtcctgcatcttcaccaccgac
ctgcgcgaggccgaggccttcctctcggcggtgggcagtgattgcggcatcgccaacgtc
aacatcggtccgagcggcgcggagatcggcggcgccttcgggggtgagaaggaaaccggc
ggcggccgcgagtccggctccgatgcctggaagggctacatgcgccggcagaccaacacc
gtgaactactcgcgggaactgccgctggcccagggcatagtcttcgactga

DBGET integrated database retrieval system