KEGG   Pseudomonas sp. ATCC 13867: H681_22210Help
Entry
H681_22210        CDS       T02524                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00564  Glycerophospholipid metabolism
pdr01100  Metabolic pathways
pdr01110  Biosynthesis of secondary metabolites
Module
pdr_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    H681_22210 (psd)
Enzymes [BR:pdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     H681_22210 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AGI26309
UniProt: M4X2I4
Position
4962842..4963711
Genome map
AA seq 289 aa AA seqDB search
MSFKDRLFILAQYLLPHHLLSRLIGCAAECRAPWFKDRLIPWFARRYQVDMREAQVEDLR
AYEHFNAFFTRVLKDGARPLDESEGSVLSPADGAISQLGPIEHGRVFQAKGHSYSLMELL
GGDAERAAPFMGGEFATVYLSPKDYHRVHMPLAGTLREMVYVPGRLFSVNQLTAAQVPEL
FARNERVVCIFDTERGPMAVVLVGAMIVASIETVWAGLVTPPKRELKSFAYDEAARAPIH
LEKGAELGRFKLGSTAIVLFGPQQVSWAENLAATSPVRMGQRLGGARQG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcaaagatcgtctgttcatcctcgcccagtacctgctgccgcaccacctgctg
tcgcgcctgatcggctgcgccgccgaatgccgcgcgccctggttcaaggaccgcctgatc
ccctggttcgcccgccgctaccaggtggacatgcgcgaggcccaggtcgaggacctgcgc
gcctatgagcacttcaatgccttcttcacccgcgtcctgaaagacggcgcccgtccgctg
gacgagagcgaaggcagcgtgctgagccccgccgacggtgccatcagccagctcggcccg
atcgagcacggccgcgtgttccaggccaagggccacagctacagcctgatggaactgctg
ggcggcgacgccgagcgcgccgcgcccttcatgggcggcgaattcgccaccgtctacctg
tcacccaaggactaccaccgcgtgcacatgccgctggccggcaccctgcgcgagatggtc
tacgtaccgggccggctgttctcggtgaaccagctgaccgccgcgcaggtgccggagctg
ttcgcccgcaacgagcgcgtggtgtgcatcttcgacaccgagcgcgggccgatggcggtg
gtgctggtcggggcgatgatcgtcgcctccatcgaaaccgtctgggccggcttggtcaca
ccgcccaagcgcgagctgaagtccttcgcctatgacgaagccgcccgcgcgccgatccac
ctggagaaaggcgccgagctgggccgcttcaagctgggttccaccgccatcgtgctgttc
ggaccgcagcaggtcagctgggctgaaaacctggcggccaccagcccggtccgtatggga
cagcgcctgggtggcgcgcgccagggctga

DBGET integrated database retrieval system