KEGG   Pseudomonas sp. ATCC 13867: H681_22445Help
Entry
H681_22445        CDS       T02524                                 

Definition
(GenBank) aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00360  Phenylalanine metabolism
pdr00362  Benzoate degradation
pdr00621  Dioxin degradation
pdr00622  Xylene degradation
pdr01100  Metabolic pathways
pdr01120  Microbial metabolism in diverse environments
pdr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    H681_22445
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H681_22445
   00622 Xylene degradation
    H681_22445
   00621 Dioxin degradation
    H681_22445
Enzymes [BR:pdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     H681_22445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AGI26356
UniProt: M4X469
Position
complement(5017822..5019420)
Genome map
AA seq 532 aa AA seqDB search
MSDSKVFLLDCTLRDGGYYNNWDFDADLVREYLQAVASAGIDYVELGLRGFPRHGFRGGY
AYSSDAFLASLPLVPGVCYGVMVNASELVQHAEGPLAAVALLFACAQGSPVDLVRIASHA
HEFEAVLPACRWLKQQGYRVGINLMQIAEQSDETILRLAASAQQFGLDVLYFADSMGSLS
PVDVRAIIALLRREWDGPLGIHAHDNRALAHANTLEAIAAGATWVDGTVLGMGRGPGNAR
IEYLAMQHGKRNLSALLQLVSRRFQPMQQRYGWGTNPYYYLAGMHGIHPTYVQEMLADSR
YSDSDLLVAIQALRTSGGKKYNPDTLEASRHFYHGAPRGEWAPQEWLADREVLLLGSGTG
VVRHRDAIEHYIRKADPVVLALNTQTDISPELIHLRAACHPLRLMADGAEHVQLPQPLIT
PASMLPEDVLNSLKGKALLDFGLSIDRQGFGFQARHCTLPTSLVAAYALAVAASGRARRV
LLAGFDGYPGEDPRNVEVNDVLEAYQAQHAVPELLAVTPTRYQVPCSSIYAL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgattcgaaagtcttcctgctggattgcacattgcgggacggcggttactacaac
aactgggacttcgacgcggatctggttcgcgagtacctgcaggctgttgccagcgcgggt
atcgactatgtcgagttgggcctgcgagggtttccccgtcacggtttccgcggcggatac
gcctacagcagcgatgcctttctcgccagcctgccgctggtgccgggtgtctgctatggc
gtgatggtcaatgccagtgagctggtccagcatgccgaagggccgcttgccgctgtggcg
cttctgtttgcctgtgcgcaggggtccccggtcgacctggtgcgcattgccagccatgcc
catgagttcgaagcggtattgcccgcttgccgctggttgaagcagcagggttaccgggtc
ggcatcaacctgatgcagatcgccgaacagtccgacgaaaccatcctgcgattggcggca
tcggcgcagcagttcgggctggacgtgctctatttcgccgacagcatgggcagcctgtcg
cccgtcgacgtacgcgcgatcatcgccctgctgcgtcgtgaatgggacggtccgctgggg
atccacgcgcatgataatcgcgcgctggcccatgccaacacactcgaggccatcgccgct
ggcgcgacctgggtcgacggcaccgtgctgggcatggggcgcggcccgggcaatgcgcgc
atcgaatacctcgccatgcagcacggcaagcgcaatctctcggcgctcctgcaactggtt
tcgaggcgcttccagccgatgcagcagcgctacggctggggcaccaatccgtattactac
ctggcgggaatgcatggcattcaccccacctacgtccaggaaatgctggccgactcgcgt
tacagcgattcggacctgctggtcgcgatccaggcgttgcgcaccagcggtggcaagaag
tacaacccggacacccttgaggcatcgcggcacttctaccacggtgctcctcggggagag
tgggccccgcaggaatggctggccgaccgggaggtactgctgctcggcagcgggaccggc
gtggtcaggcatcgcgatgcgatcgagcattacatccgcaaggccgaccccgtggtgctg
gcgctcaatacgcagaccgacatctcaccggagctgatccacctgcgggcggcctgccat
ccgctacggttgatggccgatggcgccgaacacgtgcagttaccgcagccgctgatcaca
ccggcgagcatgttgcccgaggatgtgttgaattccttgaagggcaaagcgcttctggac
tttggtttgtccatcgacaggcagggctttggtttccaggcccggcactgtacattgccg
acgtcgctggtggcggcctatgccctggcggtcgcggccagcggcagggcccggcgggtc
ctgttggcggggttcgacggctatcccggcgaggacccgcgcaatgtcgaggtcaacgat
gtactggaggcttatcaggcccagcacgcggtgcccgaactacttgcggtaacaccgacc
cgctaccaggttccctgttcttccatttatgccctttga

DBGET integrated database retrieval system