KEGG   Pseudomonas sp. ATCC 13867: H681_24850Help
Entry
H681_24850        CDS       T02524                                 

Definition
(GenBank) aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00860  Porphyrin and chlorophyll metabolism
pdr01100  Metabolic pathways
pdr01110  Biosynthesis of secondary metabolites
pdr01120  Microbial metabolism in diverse environments
Module
pdr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H681_24850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pdr01007]
    H681_24850
Enzymes [BR:pdr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     H681_24850
Amino acid related enzymes [BR:pdr01007]
 Aminotransferase (transaminase)
  Class III
   H681_24850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGI26837
UniProt: M4X6Z5
Position
5577652..5579046
Genome map
AA seq 464 aa AA seqDB search
MTASGIAQPAVDLFTARERQRFLEQNPKSVALAERAHKSLYAGVPMHWMADWSTPCPLFV
ERAQGARFYDVDGHDYVDFCLGDTGSMFGHSPAPIARALAEQGARGLTTMLPGEDAVVCG
ELLAARFGLPYWQVTATATDSNRYVLRWARAVTRRKTLLVFDGCYHGTVDDVMVRYRDGK
TVHRSGLVGQAYDLTQHSRSIPFNDVEALEAALAQGDICALLCEPAMTNIGMVLPDPGFM
QKCRELTRQYGALLIIDETHTISTDIGGCTKLWNLDPDFFVVGKPIAGGVPCGIFGCSAE
MAERMAASRQSAREDSHGHGHSGMGTTLSANALAMHCMRANLEQVMTQAAYDHMLPLARR
LADGFRALIAKHDLKWSVTELGARSEFQFCPVSPRTGAEAEAAFHDELQMALHLYLINRG
ILITPFHNMTLCCPDTTAADVDRLIETLDAGISELLAIPGAREA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcggaatcgcccaaccggccgtggatctcttcaccgcccgcgagcgccag
cgcttcctggaacagaatcccaagtccgtcgcccttgccgagcgtgcgcacaagtcgctg
tacgccggtgtgccgatgcactggatggccgactggtccacgccctgtccgctgttcgtc
gaacgcgcccagggcgcccgcttctacgacgtggacggccatgactacgtggacttctgc
ctgggcgataccggcagcatgttcggccactcgccggcgccgatcgcccgcgcgctcgcc
gaacaaggcgcacgcggcctgaccaccatgctgccgggtgaagacgccgtggtctgcggc
gaactgctcgccgcgcgcttcggcctgccctactggcaggtgaccgccaccgccaccgat
tccaaccgctacgtgctgcgctgggcccgcgcggtgaccaggcgcaagaccctgctggtg
ttcgacggctgctaccacggtaccgtcgacgacgtgatggtgcgctaccgcgacggcaag
accgtgcaccgctccggcctggtcggccaggcctacgacctgacccagcacagccgctcc
atccccttcaacgacgtcgaggcgctggaggccgcgctggcccagggcgacatctgcgcc
ctgctgtgcgagccggcgatgaccaacatcggcatggtcctgcccgatccgggcttcatg
cagaagtgccgcgagctgacccgccagtacggcgcgctgctgatcatcgacgaaacccac
accatctccaccgacatcggtggctgcacgaagctgtggaacctcgacccggacttcttc
gtggtcggcaagccgatcgccggcggcgtgccctgcggcatcttcggttgcagcgcggag
atggccgaacgcatggccgcctcgcgccagagcgcccgggaagacagccacggccacggc
cacagcggcatgggcaccaccctctcggccaacgccctggccatgcactgcatgcgcgcc
aacctggaacaggtgatgacccaggcggcctacgaccacatgctgccgctggccaggcgc
ctggccgacggcttccgcgcgctgatcgccaagcacgacctgaagtggtcggtgaccgag
ctgggcgcgcgcagcgagttccagttctgccccgtctccccgcgcaccggcgccgaggcc
gaagcggccttccacgacgagctgcagatggccctgcacctgtacctgatcaaccgcggc
atcctgatcacgccgttccacaacatgaccctgtgctgcccggacaccaccgcggcggac
gtggatcgcctgatcgagaccctcgatgcaggcatcagcgagctgctggcgattcccggg
gcgcgtgaggcctga

DBGET integrated database retrieval system