KEGG   Photobacterium damselae subsp. damselae: CAY62_02155Help
Entry
CAY62_02155       CDS       T04927                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00561  Glycerolipid metabolism
pds00640  Propanoate metabolism
pds01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CAY62_02155
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CAY62_02155
Enzymes [BR:pds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     CAY62_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ARR48487
UniProt: A0A1C3DL32
Position
I:484660..485757
Genome map
AA seq 365 aa AA seqDB search
MIPRSVTSPKKFIIGQNLLSQLPDYVKDFGDSAFLICDEFILDRVNQEAIPALQDAGLKG
ASEKFQYECTDEEIGRLDHMARELGANVIVGIGGGKTLDVAKAVAHFSHKPVIIFPTIAS
TDAPCTALSVVYNTDGSFNRYLFLPQNPDAVIADTAIISAAPARFFAAGIGDALATFFEA
RACCYADGLNLVQKKVSRTGLGLAMMCYDLILENVEMAMDAVRNHVVTPALEELIEATIY
LSGVGAESGGLAAAHAISNGMSALPALHHIQHGEKVAFGLLVQLVLEKADTEEIENVIYV
MKTAGLPLTLADFGVTEFVEADWRQVAEIACEPGDTMCNMPVKVNPQKVYQAIVAADALA
QRYHD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatcccacgtagtgttacttctcctaaaaaattcattattggtcaaaatctactttct
caacttccagattatgttaaagattttggtgattccgcttttttaatctgtgatgaattc
attttagatcgcgttaatcaagaagcgattccagcactacaagacgcgggattaaaaggc
gcgagcgaaaaattccaatacgaatgtactgatgaagaaattggtcgtttggatcatatg
gctcgtgagttaggcgccaatgtgattgttggtattggtggtggtaaaacacttgatgtt
gctaaagccgttgctcatttttctcataaacccgttattattttcccaactattgcttct
actgacgcgccatgtactgcgctatctgtggtttataataccgatggttcttttaatcgt
tatttgttcctaccacaaaacccagatgccgtgattgccgatactgctattattagtgcg
gcacctgctcgtttctttgccgcaggtattggtgatgctcttgccaccttttttgaagcg
cgtgcatgttgttatgcagatggcttaaacttagttcagaaaaaagtctctcgtaccggt
cttggtcttgcgatgatgtgttatgaccttattttagaaaacgttgagatggcgatggat
gctgtacgtaatcatgttgtcacacctgctctagaagagttgattgaagcaacaatttac
ctaagtggtgttggtgcagaatctggcggtcttgcggcagcacacgcaatcagcaatggt
atgtcggcgttgcctgctcttcaccatattcaacatggcgaaaaggttgcgttcggttta
ttggttcagcttgtgttagaaaaagcagataccgaagaaattgaaaatgtcatttatgtc
atgaaaaccgcaggtctaccgctaactttggctgattttggggttactgagtttgttgaa
gctgattggcgtcaagttgctgagatcgcatgtgaacctggcgatactatgtgcaacatg
ccagttaaagtaaatcctcagaaagtgtatcaagcaattgtagccgctgatgcattagct
caacgttaccacgactaa

DBGET integrated database retrieval system