KEGG   Photobacterium damselae subsp. damselae: CAY62_03850Help
Entry
CAY62_03850       CDS       T04927                                 

Definition
(GenBank) NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00633  Nitrotoluene degradation
pds01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CAY62_03850
Enzymes [BR:pds01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     CAY62_03850
  1.-  
   1.-.-  
    1.-.-.-  
     CAY62_03850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ARR48788
UniProt: A0A1X9TZQ3
Position
I:832504..833157
Genome map
AA seq 217 aa AA seqDB search
MSIVSVAEARYSTKAFDASRKLTDKQVADLKELVRVSASSVNSQPWHFILASTDEGKAKI
AKSMQGPYVFNERKALDASHVLVFCAKTDMDEQYLLELLESEDKAGRFANEEAKQGMHAG
RSFFVNMHLEQLHDVQAWMEKQVYLNVGTLLLGAAAMDIDAVPIEGFDADVLDAEFGLKE
KGFKSLVVVPLGFHSEEDFNAKLPKSRWEETRVFTEC
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgtttcagttgcagaagctcgttattcaactaaagcattcgatgcatcacgc
aaactaacagacaaacaagttgctgaccttaaagagttggtacgagtgagcgcatcaagt
gttaactcgcaaccttggcacttcattttagcgagtaccgatgaaggtaaagctaaaatt
gcaaaatcaatgcaaggtccgtacgtatttaacgagcgcaaagcattagatgcatcacat
gtattggttttttgtgccaaaacagatatggatgagcaatacttacttgagctattagag
tcggaagataaagcgggccgttttgctaatgaagaagcaaagcaaggtatgcacgcaggt
cgctctttctttgtaaacatgcacctagaacagcttcatgatgtacaagcttggatggaa
aaacaggtttatctaaacgttggtactctattacttggtgctgctgcgatggatattgat
gctgtgccaattgaaggttttgatgccgacgtacttgatgctgagtttggcttaaaagag
aaaggcttcaagagcttagttgttgtgcctcttggtttccatagcgaagaagattttaac
gcgaaactaccaaaatctcgttgggaagaaacgcgcgttttcactgagtgctaa

DBGET integrated database retrieval system