KEGG   Photobacterium damselae subsp. damselae: CAY62_04600Help
Entry
CAY62_04600       CDS       T04927                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00071  Fatty acid degradation
pds00280  Valine, leucine and isoleucine degradation
pds00310  Lysine degradation
pds00362  Benzoate degradation
pds00380  Tryptophan metabolism
pds00620  Pyruvate metabolism
pds00630  Glyoxylate and dicarboxylate metabolism
pds00640  Propanoate metabolism
pds00650  Butanoate metabolism
pds00900  Terpenoid backbone biosynthesis
pds01100  Metabolic pathways
pds01110  Biosynthesis of secondary metabolites
pds01120  Microbial metabolism in diverse environments
pds01130  Biosynthesis of antibiotics
pds01200  Carbon metabolism
pds01212  Fatty acid metabolism
pds02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAY62_04600
   00630 Glyoxylate and dicarboxylate metabolism
    CAY62_04600
   00640 Propanoate metabolism
    CAY62_04600
   00650 Butanoate metabolism
    CAY62_04600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CAY62_04600
   00072 Synthesis and degradation of ketone bodies
    CAY62_04600
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CAY62_04600
   00310 Lysine degradation
    CAY62_04600
   00380 Tryptophan metabolism
    CAY62_04600
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CAY62_04600
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CAY62_04600
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CAY62_04600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pds04147]
    CAY62_04600
Enzymes [BR:pds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CAY62_04600
Exosome [BR:pds04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAY62_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARR48927
UniProt: A0A1X9U016
Position
I:992791..993996
Genome map
AA seq 401 aa AA seqDB search
MERVFIVAAKRSAIGAFGGTLKDQAAGKIAAEVIKGALDAANINGAQVDEVIVGNVVGAG
QGMGVGRQASLWAGIPATVPAYSLNMVCGSGMKTVMDGVSHIRSGDAKVVVAAGVEIMSQ
IPFIVPSKVRDGQKMGNLTLTDLLIADGLTDVYNQCHMGVTAENIAKRLDISRQEQDEFA
LASQQKAVAAIEMGKFEDEIVPLEIQQRKGTITFSTDEYPKANASLDALASLRPAFDREG
SVTAGNASGINDGASAVILASESALKAHNLIPLAEIVGYAQSGLEPEIMGLGPVEAVTKA
LAQAELNLSDIAVFELNEAFAAQALGVVYQLAEKHQVEASDIIAKANPNGGAIALGHPLG
ASGNRILVTLTHELKKQRGRYGVASLCVGGGMGTAIVIKAM
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagtatttattgttgcagcaaaacgttcggcgattggcgcatttggaggcaca
ttaaaagatcaagcggcagggaaaattgctgcagaagtgattaaaggtgcattagatgcg
gcaaatattaatggcgctcaagtcgatgaagtgattgttggtaatgtggttggtgctgga
caagggatgggggtaggccgccaagcttcattgtgggctggaattccggctacagtgcct
gcttatagtcttaatatggtatgcggcagcggaatgaagacggtcatggatggcgtttct
catattcgtagtggtgatgcaaaggtggtggttgcagctggggtcgaaattatgtcccag
atcccgtttattgtgccaagcaaagttcgagatggtcaaaagatgggaaatctcacttta
accgatctcttgattgctgatggcttaaccgatgtttataaccagtgccatatgggagtt
accgcagaaaatattgctaagcggttagatatctcccgccaagaacaagatgaatttgcc
cttgccagtcagcaaaaagctgtagccgcaattgaaatgggtaaatttgaagatgagatt
gttcctcttgagattcaacaacgtaaaggaacgatcaccttttcaaccgatgaatatcca
aaagccaatgcgtctttagatgcgctcgccagtttacgaccagcttttgatcgtgaaggg
tctgtcaccgcaggtaacgcatctggaattaatgatggtgccagtgccgttattctcgct
tctgagtctgcattaaaagcacataatcttattccactcgccgaaattgtcggatatgcc
cagtctggacttgagccagaaattatggggttaggacctgttgaagcggtgaccaaagct
ttggcacaagccgaattgaatttatcagatatcgccgtatttgagctcaatgaagccttt
gccgctcaagctcttggtgtggtgtatcagttagctgaaaaacatcaggtggaagcgagc
gatattattgccaaagcaaacccaaatggtggggcaatcgcacttggccatccattaggg
gcttcgggtaaccgaattttggtcaccttgacccatgaattgaaaaaacaacgcggccga
tatggagtggcatcgctctgtgttggtggtggtatgggaaccgcaattgtcatcaaagca
atgtaa

DBGET integrated database retrieval system