KEGG   Photobacterium damselae subsp. damselae: CAY62_09140Help
Entry
CAY62_09140       CDS       T04927                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00020  Citrate cycle (TCA cycle)
pds00480  Glutathione metabolism
pds01100  Metabolic pathways
pds01110  Biosynthesis of secondary metabolites
pds01120  Microbial metabolism in diverse environments
pds01130  Biosynthesis of antibiotics
pds01200  Carbon metabolism
pds01210  2-Oxocarboxylic acid metabolism
pds01230  Biosynthesis of amino acids
Module
pds_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pds_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAY62_09140
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CAY62_09140
Enzymes [BR:pds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CAY62_09140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ARR49720
UniProt: A0A1X9U1R9
Position
I:complement(2002746..2003999)
Genome map
AA seq 417 aa AA seqDB search
MDSKVVVPVDGQKITLDSDGKLVVPNTPIIPYIEGDGIGVDVSPAMIKVVDAAVQKAYGG
DRKIAWMEIYTGEKSTHVYGEDAWLPQETLDFIREYKVAIKGPLTTPVGGGIRSLNVALR
QELDLYICARPVRYFDGVPSPVKHPELTDMVIYRENSEDIYAGVEYQAGTVEAEQVINFL
QKELGVTKIRFPQECGIGIKPISEEGTKRLVRAALQYTIDNDRDSLTIVHKGNIMKFTEG
AFKDWSYEVAADEFGAQLLDGGPWMTLKNPNTGKEIVVKDCIADAFLQQILLRPAEYDVI
ATMNLNGDYISDALAAQVGGIGIAPGANIGDGVALFEATHGTAPKYAGQDKVNPGSLILS
AEMMLRHLGWIEAADLIISSMEAAIRNKTVTYDFERLMEGATLRKCSEFADDMIEQM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggatagtaaagtcgtagtcccagttgatggccaaaaaatcacgctcgattcagacggt
aagctggtggttcctaacaccccaatcattccctatattgaaggtgatggcattggggtt
gatgtaagccctgcgatgatcaaagttgttgatgccgcagtacaaaaagcgtacggcggt
gatcgtaaaattgcatggatggaaatttatacaggggaaaaatcgacccacgtttatggg
gaagacgcatggttacctcaagagactctcgattttattcgtgaatacaaagttgcaatt
aaagggccattaacaacgcctgttggtggtggtattcgctctttaaacgtggccctgcgt
caagagcttgatttgtatatttgtgcacgtcctgtgcgctattttgatggtgttccaagt
ccagttaaacatccagaactaacggacatggtgatctaccgtgaaaactcagaagatatt
tatgctggcgttgagtaccaagcaggcacagtagaagctgagcaagtgatcaactttctg
caaaaagagctgggtgtaacaaaaattcgtttccctcaagagtgtggaatcgggattaag
cctatctcagaagaaggcactaaacgtttagtgcgtgcagccctccaatatactatcgat
aacgatcgtgactctctgactattgttcataaaggtaacatcatgaagtttaccgaaggg
gcatttaaggattggagttacgaagtggcagccgatgaatttggtgctcaactgcttgat
ggtggcccatggatgacactgaaaaatcctaatacgggtaaagagatcgtagtaaaagat
tgcattgctgatgcgttcttacagcaaattttattacgtcctgctgaatatgatgtgatt
gcaacaatgaacttaaatggtgattacatctcagatgctcttgctgctcaagttggtggt
atcggtattgctccgggagcgaatattggtgatggtgtggctctatttgaagcaacacac
ggtacagcacctaaatatgcgggccaagataaagtaaacccaggctcattaattttgtct
gctgaaatgatgcttcgtcacttaggctggatagaagctgctgatcttatcattagctca
atggaagcggctattcgtaataaaacggtgacttatgattttgaacgtttaatggaaggt
gcaacacttcgtaaatgttctgagtttgctgatgatatgattgagcaaatgtaa

DBGET integrated database retrieval system