KEGG   Photobacterium damselae subsp. damselae: CAY62_11120Help
Entry
CAY62_11120       CDS       T04927                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pds  Photobacterium damselae subsp. damselae
Brite
KEGG Orthology (KO) [BR:pds00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pds03016]
    CAY62_11120
Enzymes [BR:pds01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CAY62_11120
Transfer RNA biogenesis [BR:pds03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CAY62_11120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ARR50035
UniProt: A0A1X9U2M4
Position
I:complement(2396642..2397421)
Genome map
AA seq 259 aa AA seqDB search
MYDVTLDTPLIPKVELEILYQDEYLVVVNKPSGMLVHRSWLDSHETVFVMQTLRDQIGQH
VFPLHRLDRPTSGVLLFALSSEMAAEMMPKFAGRDVHKTYHAVVRGWVKEAAVLDYPLKK
EIDKIADKNASKEQEAQPAVTAYAPIAKVEVPIAVGRYSCSRYSLVEMKPETGRKHQLRR
HMHHLSHHIIGDVNHGDGRHNRMFRDNYDCHRLMLHASRIQFEHPITKQMLDIRAQVDET
WLRVMAAFNWDVALLQPQA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgtcacgctagatacaccactaattccaaaagtagaacttgagatcttgtat
caagatgagtatctcgttgtcgttaataagccatcgggtatgttagtacaccgttcttgg
ttagatagtcatgaaacggtatttgtgatgcagacgctgcgcgatcaaattggtcagcat
gtttttccactccatcgtttggatcgaccaacatcgggtgttttactgtttgcgctttca
agtgaaatggcagcggagatgatgcctaagtttgctggtcgcgatgttcataaaacatat
cacgctgtagttcgaggttgggtaaaagaggcggcagttctggattatccgctaaaaaaa
gagatcgataaaatagcagataagaatgccagcaaagaacaggaagcccagcctgctgtt
acagcttatgcgccgattgctaaagttgaagtacctattgctgttgggcgttatagctgt
agtcgttatagcctagttgaaatgaagcctgagaccggccgcaaacatcagttacgtcgt
catatgcaccatttaagtcatcatattattggtgatgtaaaccatggtgatggtcgtcat
aatcgaatgttccgagataactatgattgccatcgtctaatgttgcacgcttcaagaatt
caatttgagcatcctataacaaaacagatgcttgatattcgagctcaggttgatgaaacc
tggttacgagttatggccgcttttaattgggatgtcgctttgttacaaccacaagcttaa

DBGET integrated database retrieval system