KEGG   Photobacterium damselae subsp. damselae: CAY62_11210Help
Entry
CAY62_11210       CDS       T04927                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pds  Photobacterium damselae subsp. damselae
Brite
KEGG Orthology (KO) [BR:pds00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pds03009]
    CAY62_11210
Enzymes [BR:pds01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     CAY62_11210
Ribosome biogenesis [BR:pds03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CAY62_11210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ARR50051
UniProt: A0A1X9U2L0
Position
I:complement(2414902..2415990)
Genome map
AA seq 362 aa AA seqDB search
MNQVLLYCRPGFEKECAGEVQDKANKLELYGFPRVKNNTGYVVFEFYQQGDGDKFIQLQP
FAELIFARQMIAVSPLLADLPADDRISPILSAISEDFPRCGDIRIETPDTNDAKELSKFC
RKFTVPLRAALRKADVLYKKDNPKKPVLHVCFIAPGCCYVGYSYSNNNSPFFMGIPRLKF
PADAPSRSTLKLEEAFHVFIPREEWDERLAPGMWGVDLGACPGGWTYQLVKRSMFVHSID
NGQMAQSLMDTGQVRHHEVDGFKFEPPRKNVTWIVCDMVEKPARVAHLMGEWISKGWARE
AIFNLKLPMKGRYDEVLQDIENLKLFLIKNGVKFSLQAKHLYHDREEITVHLRCLDNRLH
IN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaagttctattgtactgtcgtccaggctttgaaaaagaatgtgccggtgaagtt
caagacaaagcgaataaactggagttgtatggtttccctcgggtaaaaaacaataccggc
tatgtagtttttgaattttatcagcaaggtgatggcgataagtttatccagcttcaaccg
tttgctgagttgatctttgctcgtcaaatgattgcagtttcaccattgttggctgatctt
cctgccgatgatcgtattagtcctattttgtctgcaatcagcgaagattttcctcgttgt
ggcgatatccgcatcgagacaccagatactaatgatgcaaaagagctatcaaagttctgt
cgtaagtttactgtgccattgcgtgcggctctgcgaaaagcagatgttctatacaagaaa
gataatccgaagaagccagtactgcatgtttgttttattgcgcctggttgttgttatgtt
ggttactcatactcaaacaataactcgccattctttatggggatccctcgtcttaagttc
ccagcagatgcgccaagccgttcaacactaaaactggaagaggcatttcatgtctttatt
cctcgtgaagagtgggatgagcgtctagctccgggtatgtggggtgttgacttaggtgca
tgtccaggtggttggacttatcagttagtgaagcgttcaatgttcgttcactcaattgat
aatggccagatggctcaaagcctaatggataccggacaagttcgtcaccatgaagtcgat
ggctttaagtttgagccaccacgtaaaaacgtgacttggattgtttgcgacatggtagaa
aaaccagctcgtgttgcgcatttgatgggtgaatggatcagcaaaggttgggcgcgtgaa
gcgatctttaacctaaaactgccaatgaaaggccgttatgatgaagtgctgcaagatatt
gaaaatctaaagctatttttaattaaaaacggcgtgaagttttcactacaggctaagcac
ttatatcatgaccgtgaagagattacagttcatcttcgttgtttagataaccgtctgcac
atcaactaa

DBGET integrated database retrieval system