KEGG   Prevotella dentalis: Prede_1623Help
Entry
Prede_1623        CDS       T02403                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pdt  Prevotella dentalis
Pathway
pdt00240  Pyrimidine metabolism
pdt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Prede_1623
Enzymes [BR:pdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Prede_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 Dev_Cell_Death UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AGB28928
UniProt: L0JDK6
Position
2:complement(157052..157675)
Genome map
AA seq 207 aa AA seqDB search
MMENLTGEAHRPGRIEVVCGSMFSGKTEELIRRLKRAQFARQNVEIFKPALDTRYSEINV
VSHDNNAIHSTPVDNAETILRLSAGHEVVGIDEAQFLDDKLVEVCNAMANKGIRVIVAGL
DMDYLGVPFGPIPALCAVADEVTKVHAICVKCGALAYASHRLVHNDAQVMLGEKMEYEPL
CRSCFQKALEEDRRNAQSRSLFEHVAP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaatctaacaggggaagcccaccgccccggcagaatagaggtggtttgcggc
tccatgttctccggaaaaaccgaggagctgattcgccggctgaaacgagctcagtttgcc
cgccagaatgtggaaatattcaaaccggcactggacacacggtactcggagatcaatgtg
gtaagccatgacaacaacgccatccactccacgcccgttgacaatgcagagaccatcctc
cgactgtctgcaggtcatgaggttgtgggcattgacgaggcgcagtttctggacgataag
ctcgtcgaagtgtgcaatgctatggccaacaaaggcatccgcgtcattgtggccgggctg
gacatggactatctcggagttcctttcggccctatccccgccctatgcgccgtggccgat
gaggtgaccaaggtgcatgccatctgcgtgaaatgcggggcactggcctatgccagccac
cggctggtgcacaacgacgcccaggtcatgctcggcgagaagatggaatacgaacccctg
tgccgaagttgctttcagaaagcactcgaggaagaccggcgaaacgcccagtccagaagc
ctctttgagcatgtagccccttga

DBGET integrated database retrieval system