KEGG   Prevotella dentalis: Prede_1941Help
Entry
Prede_1941        CDS       T02403                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pdt  Prevotella dentalis
Pathway
pdt00260  Glycine, serine and threonine metabolism
pdt00630  Glyoxylate and dicarboxylate metabolism
pdt00670  One carbon pool by folate
pdt01100  Metabolic pathways
pdt01110  Biosynthesis of secondary metabolites
pdt01130  Biosynthesis of antibiotics
pdt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Prede_1941
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Prede_1941
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Prede_1941
Enzymes [BR:pdt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Prede_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AGB29221
UniProt: F9D5I8
Position
2:569373..570458
Genome map
AA seq 361 aa AA seqDB search
MNKRTCLYERHQAMGALIQPFGGFDMPIQYSSIIDEHQAVRRHCGVFDVSHMGEVVVRGR
DAERYVNHIFTNDVSGAPLYQIFYGMMLYPGGGTVDDLLVYKMGNEEFFIVINAANIDKD
VEWMRRHAEGFDVVLDHASDRYGQLAVQGPEAEEVMEQVLALPCRELSFYTAKTLEAAGE
TVIVSRTGYTGEDGFEIYGSHAFIVAQWDRLMDSHRCTPCGLGCRDTLRFEVGLPLYGDE
LSPDISPVMAGLGMFCKLDKPEFIGREALVRQKAEGVARRLRGIEIDDRAVPRHGYKVMA
DGQEVGEVTTGYRLISVDKSCAVALVDSRLQLGDRVEVQIRKKLFPGTIVKKKFYEKHYK
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgaacctgtctctacgagcgccaccaggccatgggtgcgctcatccagccc
tttggcggattcgacatgcccatacagtattcatccatcatcgacgagcaccaggccgtg
cgccggcactgcggcgtgttcgacgtgtcgcacatgggcgaggtggtggtgcgcggccgc
gacgccgagcgatacgtgaaccacatcttcaccaacgacgtgtcgggcgcccccctctac
cagattttctacggcatgatgctctatcccggcggcggcaccgtggatgatttgctggtc
tacaagatgggcaacgaggagttttttatcgttatcaatgcagccaatatcgacaaagac
gtggagtggatgcgccgccatgccgaggggtttgacgtggtgctcgaccacgcttccgac
cgctacggccagctggccgtgcagggacctgaggccgaagaggtgatggagcaggtgctt
gcactgccctgccgcgagctctcgttctacacggcgaagacccttgaggccgcgggcgag
accgttatcgtgagccgaacaggctacacgggcgaggacgggttcgagatctatggctcc
cacgctttcattgtggcccagtgggatcggctcatggacagccaccgatgcacgccctgc
ggcctgggctgccgcgacacgctgcgcttcgaggtggggttgccgctctacggcgacgag
ctctcgcccgacatctcgcccgtcatggcgggtctcggcatgttctgcaagctcgacaag
cctgagtttatcggccgcgaagccctcgtgcggcagaaagccgagggcgtggcccgccgt
ctgcgcggcatcgagatcgacgaccgcgctgtgccgcgccacggctacaaggtgatggcc
gacggccaggaggtgggcgaggtgaccaccggctaccgccttatctccgtggacaagagc
tgtgccgtggccttagtggacagccgtctgcagctcggcgaccgcgtggaggtgcaaatc
cgcaagaagctcttccccggcaccatcgtcaaaaagaagttctacgagaagcattacaag
aagtaa

DBGET integrated database retrieval system