KEGG   Paenibacillus durus: PDUR_00610Help
Entry
PDUR_00610        CDS       T03297                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
pdu  Paenibacillus durus
Pathway
pdu00010  Glycolysis / Gluconeogenesis
pdu00030  Pentose phosphate pathway
pdu00051  Fructose and mannose metabolism
pdu00680  Methane metabolism
pdu01100  Metabolic pathways
pdu01110  Biosynthesis of secondary metabolites
pdu01120  Microbial metabolism in diverse environments
pdu01130  Biosynthesis of antibiotics
pdu01200  Carbon metabolism
pdu01230  Biosynthesis of amino acids
Module
pdu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pdu_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PDUR_00610
   00030 Pentose phosphate pathway
    PDUR_00610
   00051 Fructose and mannose metabolism
    PDUR_00610
  09102 Energy metabolism
   00680 Methane metabolism
    PDUR_00610
Enzymes [BR:pdu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PDUR_00610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase ThiG CutC UvrA_inter
Motif
Other DBs
NCBI-ProteinID: AIQ10703
UniProt: A0A089HJX4
Position
126014..126868
Genome map
AA seq 284 aa AA seqDB search
MPLVSMTDMLNKALAGKYAVGQYNINNLEWTQAILGAAEEEKSPVILGVSEGAARHMGGF
NTVVKMVEGLIQDMKITVPVTIHLDHGSSFDKCKEAIDAGFTSVMIDGSHHPIEENIEMT
KKVVDYAHSKGASVEAEVGTVGGQEDDVIGGIMYAKLEECVAIVKETGVDALAPALGSVH
GPYLGEPNLGFKEMEEVRDAVKIPLVLHGGTGIPKHDIDKAISLGTSKINVNTENQIAFA
KVVREVLAAKPEAYDPRTFIAPGREAIKQTVIGKIREFGSNNKA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgccattggtatcaatgacagacatgttgaacaaagctcttgcaggaaaatatgcggtt
ggtcagtacaacatcaacaacctggagtggacccaagcgattttgggtgctgctgaagaa
gagaagtccccggttatcctgggtgtatccgaaggcgcagctcgtcatatgggcggattc
aacaccgtggtgaaaatggtagagggtctgattcaagatatgaaaattaccgttccggta
actattcacctcgaccatggttcgagcttcgacaagtgtaaagaagccatcgacgccgga
tttacttccgtcatgatcgacggctcccaccatccgattgaagaaaatattgaaatgacc
aagaaggtcgttgattacgctcattccaaaggcgcttccgtagaagctgaagttggtacg
gttggcggtcaggaagatgacgttattggcggcattatgtacgccaaactggaagaatgc
gtagctatcgtaaaagaaaccggcgtcgatgccctggctcctgcgcttggttccgtacat
ggaccttacctcggcgagcctaaccttggattcaaggaaatggaagaagttcgcgacgcg
gttaaaattccgcttgttcttcatggcggtacaggcatcccgaaacatgacattgacaaa
gcaatctccctgggaacttccaaaatcaacgtgaacaccgagaaccaaatcgcattcgcc
aaggttgtccgtgaagtgctggccgctaaaccggaagcctatgatcctcgtacatttatc
gcaccaggccgcgaagctatcaaacaaacagtaatcggcaaaatccgcgaattcggttcc
aacaacaaagcgtaa

DBGET integrated database retrieval system