KEGG   Paenibacillus durus: PDUR_09100Help
Entry
PDUR_09100        CDS       T03297                                 

Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
pdu  Paenibacillus durus
Pathway
pdu00460  Cyanoamino acid metabolism
pdu00500  Starch and sucrose metabolism
pdu01100  Metabolic pathways
pdu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PDUR_09100
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PDUR_09100
Enzymes [BR:pdu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     PDUR_09100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIQ12063
UniProt: A0A089HNV9
Position
1942572..1943915
Genome map
AA seq 447 aa AA seqDB search
MRTVQFPQDFVWGAATAAYQIEGAYNEDGRGMSIWDTFSRIPGKVDNMDNGDVACNSYHL
YLEDIALMKELGITSYRFSIAWPRIFPAGTGEVNAKGLEFYHAFVDALLENGIEPVCTLY
HWDLPQSLQDSGGWENRETVDAFAAYAETLFRSLGGKIKKWLTINEPWCVSFLSNYQGTH
APGNKDLQTAVTVAHHLLLAHGSAVRKFRESGLPGEIGYAPNVTWMEPYSSRKKDIEACK
RENGWYVEWFMDPVFKGEYPSFLVKWFREKGAEVPILKGDMELIHEKIDILGINYYSGSL
ARYDEDAGLTACGPVEMGYDRTDIGWPIYPEGFYKVLSYIQNRYGDIPIYITENGACYND
GPDNGIVADTKRVGYLHKHLLQLHRCISNGIPVKGYFAWSLLDNFEWAYGYSMRFGLVHT
DYDTLARTPKDSFYWYQDVIATGEVES
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgtacagtttccacaagattttgtctggggagcggcaaccgctgcatatcaa
attgaaggggcttacaatgaagatggaagagggatgtcgatttgggatacgttttcccgc
attccaggcaaggtagacaacatggacaatggggatgtcgcctgcaacagttatcatctg
taccttgaggatatcgccctgatgaaggaactcggaatcacatcataccggttctccatc
gcatggccgcgtatttttccggcaggcacgggagaggttaacgccaaaggacttgagttc
tatcatgctttcgttgacgctctgcttgagaatggaatcgaacctgtatgcacgctgtat
cattgggacctgccgcaatctcttcaggattcggggggatgggagaacagggagacggtg
gatgcatttgccgcctatgccgagacgctgttccgcagcctgggaggaaaaatcaagaaa
tggttgacgattaacgagccttggtgcgtgtcgtttctttccaactaccagggaacacac
gcgccaggcaataaggatttgcagactgctgttaccgtcgcccaccatctgcttctcgct
cacggcagcgcggtacgaaaatttagagaatcggggcttccgggagagatcggttatgcg
cccaatgtaacctggatggagccgtacagcagccgaaagaaggatatcgaagcctgcaaa
cgggagaacggctggtatgtggagtggttcatggacccggtgtttaagggcgagtatccg
tcttttctggtgaaatggttccgtgagaagggagcggaggtgccgatcctgaaaggggat
atggagctcattcatgagaagatcgatatcctgggcatcaactattattccggttcattg
gcaaggtacgatgaagacgccggtcttacggcatgcgggccggtggagatggggtatgac
cggacggatatcggctggccgatttatccggaaggcttttacaaagtgctaagctatatt
cagaaccggtacggcgacattccaatctacattaccgagaacggggcctgctacaacgac
gggccggacaacggaatcgtagcggatacgaagcgggtcggttatctgcacaagcatctg
cttcagcttcaccgctgcatctcgaatggcattccggttaaagggtattttgcctggtca
ctgcttgacaatttcgaatgggcctatgggtacagcatgcggttcggtctcgttcatacg
gattatgatacgcttgcccgtacgccgaaagacagcttttattggtatcaggatgtaatc
gcaaccggtgaggttgagagctga

DBGET integrated database retrieval system