KEGG   Paenibacillus durus: PDUR_18850Help
Entry
PDUR_18850        CDS       T03297                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pdu  Paenibacillus durus
Pathway
pdu00051  Fructose and mannose metabolism
pdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PDUR_18850
Enzymes [BR:pdu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     PDUR_18850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh F420_oxidored UDPG_MGDP_dh_N NAD_binding_10 ApbA NAD_Gly3P_dh_N Sacchrp_dh_NADP NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIQ13746
UniProt: A0A089HP06
Position
complement(4185766..4186995)
Genome map
AA seq 409 aa AA seqDB search
MKAVHFGAGNIGRGFIGPVLSRSGYNVCFVGRNKRKIAELQKRGQYPVTLANENRDKFIV
DNVTAINLNDTEKVAEAIADAELVTTAVGVSALKDIAGTIARGIELRLSQSGTPQPLHII
ACENGIGGSQRLRKSVYRHLRPDVIKRADRIVAFPNTMVDRIVPVQKHADPLAVMVEPFS
EWIVPRSGMIGDYNEIEGVRYVDSLDPYLERKLFTVNTGHCSAAYFGYLEGYTSLQEAMS
DPVIRSRVYGVLQETGAMLVHLYGFDPAQHEKYIKKMMERFANRNFKDKVSRVARSPLRK
LSPNERLVRPALKAHELGFETSHLVSAIASALLYENNDDPEAVSLQMAIRSSGIEKVVSD
ELGIPAEHPLHSRIVEEYFNTCVKYQHKAGLGFETLTDSLSPSAISDNP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccgtacattttggagctggcaatattggcagagggtttatcggccccgtcttg
tctcgctccggttataacgtttgttttgtcggacgcaataagagaaagattgccgaactg
caaaaaaggggacaatatccggtcaccctggccaacgagaaccgggacaaatttattgtg
gataatgtaacagccattaatttgaatgataccgagaaggtagcggaagcgatcgccgat
gcggaactcgtaacgactgccgtcggagtctccgcgctgaaggatattgcgggaacgata
gcccgcggtatcgagctgcggctgagccaaagcggcacaccccagcccctgcatattatc
gcctgcgagaatggcatcgggggaagccagcggttgagaaaatccgtatatcggcatttg
cggccagacgtgatcaagcgagccgaccgcattgtagcgtttccgaatacgatggtcgac
cgcattgtgcccgtccagaagcatgccgacccgctggcggtcatggttgaacctttcagc
gagtggattgtccctcgaagcgggatgatcggcgattataacgagattgaaggggtccgt
tatgtcgattcacttgatccctatctggaacggaagctgtttaccgttaacacgggtcat
tgcagcgccgcttatttcggatatcttgaaggctatacttcacttcaggaagcgatgtct
gatcctgttatccgctcccgggtatatggcgtcctgcaagaaacgggggcgatgctggta
cacttatacggattcgacccggcgcagcatgagaagtacattaagaaaatgatggaacgc
ttcgcaaaccgcaacttcaaagataaagtttcgcgagtggccagatctccgctccgcaag
ctttccccgaatgaacggctcgtacggcctgcgctgaaggcccatgagcttggattcgaa
acttctcatttggtctcggctattgcctccgcgctgctctatgagaataatgatgatcca
gaggcggtaagtcttcaaatggctattcggagttcgggtattgaaaaggtagtgtccgat
gaattgggcattccggccgaacatccgctgcacagccgcattgtggaggaatatttcaac
acctgtgtaaaataccagcataaggccggcttgggctttgagacgcttaccgactcctta
agcccttcggcgatatccgacaacccgtaa

DBGET integrated database retrieval system