KEGG   Pseudonocardia dioxanivorans: Psed_0131Help
Entry
Psed_0131         CDS       T01479                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K18382  NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psed_0131
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Psed_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N Glu_dehyd_C Shikimate_DH ThiF MTS adh_short NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AEA22407
UniProt: F4CQG9
Position
complement(143546..144574)
Genome map
AA seq 342 aa AA seqDB search
MKAVRVHEYHSDPKIDDIPEPTLQGPLDVIVKIGGAGVCRTDLHIINGDWAEAMGPELPY
VIGHENAGWVEAVGEGVTNVAVGDTVILHPQPSCGLCLPCRRGRDMQCENAFFPGLSNND
GGMAEYLRTTARACIKLDPSTNPADVAALADAGITAYHAVRKAVPDLYPGTTAVVQGAGG
LGHIAIQALAAITGTRIVVVDRNPDALALAKQIGADETVLADGNQVDAVKDITNGRGGDV
VFDFVAEQGAELDAWQMTAPAGSQYILGYGGTFTAPTLDFVGGEKNVIGNIVGTYADLTE
LMVLAQAGKVTLHTKKYPLDAALDALHDLDAGRVRGRAILVP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccgtccgggtgcacgagtaccactccgacccgaagatcgacgacatccccgag
cccacgctgcagggacccctcgacgtcatcgtcaagatcggtggcgcaggggtctgccgg
accgacctgcacatcatcaacggcgactgggccgaggccatgggccccgagctgccgtac
gtgatcggccacgagaacgccggctgggtagaggccgtcggcgagggtgtcaccaacgtc
gccgtgggcgacaccgtcatcctgcatccgcagccgtcgtgcgggctgtgcctgccctgc
cggcgcggtcgcgacatgcagtgcgagaacgcgttcttccccggcctgtcgaacaacgac
ggcggcatggcggagtacctgcgcaccaccgcgcgggcctgcatcaagctcgacccgagc
accaacccggccgacgtcgccgcactggccgacgccggcatcaccgcctaccacgcggtc
cgcaaggcggtgccggacctctaccccggcaccacagccgtcgtgcagggtgcgggcggc
ctcggccacatcgccatccaggcgctcgcggccatcaccggcacccggatcgtcgtcgtc
gacaggaaccccgacgcgctcgccctcgcgaagcagatcggtgccgacgagaccgtcctc
gccgacggcaaccaggtcgatgccgtcaaggacatcaccaacgggcgcggcggcgacgtg
gtgttcgacttcgtcgccgagcagggcgccgagctcgacgcctggcagatgaccgcgccc
gccggttcgcagtacatcctgggctacggcggcacgttcaccgcgccgacgctcgacttc
gtcggcggcgagaagaacgtcatcggcaacatcgtcgggacctacgccgacctgaccgag
ctgatggtcctggcccaggcgggcaaggtcacgctgcacaccaagaagtacccgctcgat
gcggcgctcgacgcgctgcacgacctcgacgccggtcgtgtccgcggccgggcgatcctc
gttccgtga

DBGET integrated database retrieval system