KEGG   Pseudonocardia dioxanivorans: Psed_0814Help
Entry
Psed_0814         CDS       T01479                                 

Definition
(GenBank) Toluene-4-monooxygenase system B
  KO
K15761  toluene monooxygenase system protein B [EC:1.14.13.236 1.14.13.-]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00623  Toluene degradation
pdx01100  Metabolic pathways
pdx01120  Microbial metabolism in diverse environments
pdx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Psed_0814
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     Psed_0814
    1.14.13.-  
     Psed_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TmoB DUF2866 ubiquitin
Motif
Other DBs
NCBI-ProteinID: AEA23070
UniProt: F4CQQ2
Position
complement(862870..863178)
Genome map
AA seq 102 aa AA seqDB search
MTENATVELPIEDQAPQVVPLNAVFADDFVQILVPVTTADTVREVAAAVAHHVEGKRVRA
LPYEKVVFHNGRRLPPEMTVAEAGIAPLDHVRVEYDIPKGKS
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaatgccacggtggagctccccatcgaggaccaggcgccgcaggtggtgccg
ctgaacgcggtcttcgccgacgacttcgtgcagatcctggtgccggtgaccaccgcagac
accgtccgcgaggtcgcggccgcggtcgcgcaccacgtcgagggcaagcgggtccgcgcc
ctgccctacgagaaggtcgtcttccacaacggcaggcgcctgccaccggagatgaccgtc
gccgaagcgggcatagcgccgctggatcacgtccgcgtcgagtacgacatcccgaagggc
aagtcatga

DBGET integrated database retrieval system