KEGG   Pseudonocardia dioxanivorans: Psed_1471Help
Entry
Psed_1471         CDS       T01479                                 

Definition
(GenBank) Limonene-12-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psed_1471
Enzymes [BR:pdx01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Psed_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LEH SnoaL_2 DUF4440 SnoaL_3 NTF2
Motif
Other DBs
NCBI-ProteinID: AEA23710
UniProt: F4CSK0
Position
complement(1540954..1541340)
Genome map
AA seq 128 aa AA seqDB search
MTSARATVERFLAAVGAGDPDAAAACFAPGATYANMPHPPVVGPEGVRGLLAPILDRAEY
VEWEIVTASFAETRAWLERVDRFRIDGREYAIECNGVVEIDPDSGLITAFRDYVDLGLWR
SRLGDALG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgcccgcgccacagtcgagaggttcctcgccgccgtcggcgccggggacccc
gacgccgccgcggcctgcttcgcccccggcgcgacgtacgcgaacatgccgcacccgccc
gtcgtcggccccgagggcgtgcgagggctgctcgcgccgatcctcgaccgtgccgagtac
gtcgagtgggagatcgtcaccgcgagcttcgccgagacgcgggcctggctggaacgagtc
gaccggttccgcatcgacggccgcgagtacgccatcgagtgcaacggcgtcgtcgagatc
gacccggacagcgggctgatcacggcgttccgcgactacgtcgacctcggcctgtggcgg
tcccggctcggagatgcgctgggatga

DBGET integrated database retrieval system