KEGG   Pseudonocardia dioxanivorans: Psed_2165Help
Entry
Psed_2165         CDS       T01479                                 

Definition
(GenBank) Ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psed_2165
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Psed_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: AEA24388
UniProt: F4CL09
Position
2310856..2311785
Genome map
AA seq 309 aa AA seqDB search
MTPRVLVVGAVNVDLVVHTDRLPGPGETVVGPGVARHGGGKGANAAVAAARAGAEVRYCG
AVGADDTGTGALADLRAEGIDVTDVAVLEDVATGTALIVVDGRGENQIAVGAGANAAVEP
AAVRAAVARSAEWAGCVLVSTEIPPEAVAAAVETTVAHGLACVLNPAPVAAGLVDLLRLG
PVVTPNRSELRDLYALVEEGTAGSVAEMATAVAALTGASVVVTLGGDGVLIVDPERGVTS
LPAPPADVRDTTGAGDTFNGVLAAALAAGAAVPEAVARGVAAASLSVGTVGARAGMPRAA
AIDGATGPG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgccccgggtgctcgtggtcggcgcggtgaacgtcgacctggtggtgcacaccgac
cggctgccggggcccggggagaccgtggtgggtccgggcgtcgcgcggcacggcggtggg
aagggtgcgaacgcggcggtcgccgcggcccgggccggcgcagaggttcgctactgtggt
gccgtcggcgcggacgacaccggaaccggtgctctggccgacctgcgcgcggaggggatc
gacgtcaccgacgtggccgtgctcgaggacgtcgccaccggcacggccctgatcgtcgtc
gacggccgcggggagaaccagatcgcggtgggagccggggccaacgcggccgtggaaccg
gctgcggtgcgcgccgcagtggcgcgctcggcggagtgggccggctgcgtgctggtcagc
accgagatcccgccggaggcggtcgcggcggcggtggagacgacggtggcgcacgggttg
gcgtgcgtgctcaaccccgcaccggtggccgcgggcctggtggacctgctccggctcggc
ccggtcgtcacgccgaaccggtctgagctgcgggacctctacgcgctggtggaggagggt
acggccggctcggtcgcggagatggcgaccgcggtggccgctctgaccggcgcatcggtg
gtggtgacgctcggcggcgacggggtcttgatcgtcgaccccgagcggggggtgacgtcc
ctgcccgccccgcccgcggacgtccgggacaccaccggcgcgggcgacacgttcaacggg
gtgctcgcagccgcgctggccgctggagccgcggtccccgaggccgtcgcccggggcgtg
gcggcagcctcgctgtccgtcggcacggtcggggcacgagccggcatgccacgggctgcg
gcgatcgacggagcgacggggccgggctga

DBGET integrated database retrieval system