KEGG   Pseudonocardia dioxanivorans: Psed_2866Help
Entry
Psed_2866         CDS       T01479                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00260  Glycine, serine and threonine metabolism
pdx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01130  Biosynthesis of antibiotics
pdx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psed_2866
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psed_2866
Enzymes [BR:pdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psed_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: AEA25066
UniProt: F4CMW7
Position
3030990..3031787
Genome map
AA seq 265 aa AA seqDB search
MTVSDVFTRCAAQGRGALVGYLPAGFPTVDGSVDLISAMVDGGCDLVEVGIPYSDPVMDG
PTIQAAAETALRAGVRLRDVFTVVERVAAAGGSAVVMTYYNPVLRYGVDAFARDLAAAGG
LGVITPDLIPDEADEWLAASTAHGLDRIFLVAPSSTEERIASTVAACTGFVYATSIMGVT
GARDSVADVAPEIVARTRPHTRLPIGVGLGVRSGEQAAQVASFADAVIVGSAFVSAATDR
GTDGVHDLAAELADGVRRAGVPAPA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacggtctcggacgtgttcacccgctgcgccgcccagggtcgtggcgcgctcgtcggc
tacctgccggccgggttcccgaccgtcgacggctcggtcgacctgatcagcgcgatggtc
gacggtgggtgcgacctcgtcgaggtcggcatcccgtactccgaccccgtgatggacgga
ccgacgatccaggccgccgccgagaccgcgctgcgcgccggggtccggttgcgcgacgtc
ttcaccgtcgtcgagcgcgtcgccgccgccgggggctcggccgtcgtcatgacgtactac
aacccggtgctgcggtacggcgtcgacgcgttcgcgcgcgacctcgccgccgcgggcggg
ctcggcgtgatcacgcccgacctcatccccgacgaggccgacgagtggctcgcggcgtcg
accgcccacgggctcgaccggatcttcctggtcgcgccgtcctcgaccgaggagcgcatc
gcctcgaccgtcgccgcctgcaccggcttcgtctacgcgacgtcgatcatgggggtgacc
ggtgcccgtgacagcgtggccgacgtggcgccggagatcgtcgcgcgcacccggccgcac
acgcggctgccgatcggcgtgggtctgggggtgcggtcgggcgagcaggccgcgcaggtg
gcgtcgttcgccgacgcggtgatcgtcggctcggcgttcgtctccgccgccaccgaccgc
ggcaccgacggcgtgcatgacctcgccgccgagctggccgacggcgtccgccgcgccggg
gttcccgccccggcctga

DBGET integrated database retrieval system