KEGG   Pseudonocardia dioxanivorans: Psed_3034Help
Entry
Psed_3034         CDS       T01479                                 

Definition
(GenBank) Pyruvate carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00620  Pyruvate metabolism
pdx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psed_3034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdx02000]
    Psed_3034
Enzymes [BR:pdx01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Psed_3034
Transporters [BR:pdx02000]
 Other transporters
  Primary active transporters [TC:3]
   Psed_3034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AEA25233
UniProt: F4CRE2
Position
complement(3232204..3233712)
Genome map
AA seq 502 aa AA seqDB search
MSEVRFLDTTFRDGSQSLWAMGIRYGMMEALAGDLDRAGFSHIEVPANAIFFKKMVRDLR
EDPWDTMRMLARTITRTPTTCMGGAGGNLNGFGTPTAPVLGELFAEKLAEIGVMNRAQLM
ANTADQTTRQFPTAVPRARELGLTVALAVCYTISPRHTDEHFAETTRRCAALKPDVIYIK
DAGGLLTVDRIRTLLPVVLREAGDIPVELHSHCTTGLAPVVYLEALQLGVKTLHCGVPPL
ADGSAQPSVLTTARNARILGFTPTVDEELLASVSARLGEFARRDGMPLGVPLAHDADHYR
HQIPGGVISNLRHQLAGIGMADRLADVLEECVRIREELGYPIMITPYSQYVATQAAIHVA
SGKRYDVVIDELVRFAQGAYGEDSGYTWMDPDLRDRFLALPRAAQLAEAARHAPADVGLD
DVRRSIGAPGISDEELILRAIMQGTAEIDAMRAAGPPRTYHSGDLPLRTLIDRLGETSRV
RYVQVARRGTSMELRTRQEATS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaggtccggttcctcgacacgacgttccgtgacggctcgcagtccttgtgggcc
atggggatccgctacgggatgatggaggccctcgcgggcgacctcgaccgggccgggttc
tcccacatcgaggtgccggcgaacgcgatcttcttcaagaagatggtccgcgacctgcgc
gaggacccgtgggacaccatgcggatgctcgcccgcacgatcacccgcaccccgacgacg
tgcatgggcggcgccggcggcaacctcaacggcttcggcacccccaccgcgccggtcctc
ggcgagctgttcgccgagaagctcgccgagatcggcgtgatgaaccgcgcgcagctgatg
gcgaacaccgccgaccagaccacgcgccagttccccaccgcggtgccacgggcccgcgag
cttggcctgaccgtcgcgctcgccgtctgctacaccatctcgccgcggcacaccgacgag
cacttcgccgagaccacccggcgctgcgcggccctgaagcccgacgtgatctacatcaag
gacgcgggtggcctgctcaccgtcgaccgcatccgcacgctgctgcccgtcgtactgcgg
gaggccggggacatccccgtcgagctgcactcgcactgcaccacgggcctcgccccggtc
gtctacctggaggcgctgcagctgggcgtgaagaccctgcactgcggtgtcccgccgttg
gccgacggctcggcccagccgtcggtgctcaccaccgcgcgcaacgcccgcatcctgggc
ttcaccccgacggtcgacgaggagctgctggcatcggtgtcggcacggctcggggagttc
gcccggcgcgacgggatgccgctgggggtgccgctggcccacgacgccgaccactaccgc
caccagatcccgggcggcgtcatctccaacctgcgccaccagctcgccgggatcgggatg
gccgaccggctcgccgacgtcctcgaggagtgcgtgcggatccgcgaggagctcggctac
ccgatcatgatcacgccgtactcccagtacgtcgcgacacaggccgcgatccacgtcgcc
tcgggcaagcgctacgacgtcgtcatcgacgagctggtccggttcgcccaaggcgcctac
ggcgaggactccgggtacacctggatggaccccgacctgcgcgaccggttcctcgcgctg
ccgcgggcggctcagctggccgaggccgcccggcacgctcccgccgacgtcggcctcgac
gacgtgcggcggtccatcggggctcccggcatctccgacgaggagctcatcctgcgggcg
atcatgcagggcaccgcggagatcgacgccatgcgcgccgccggaccgccccgtacctac
cactccggcgacctccccctgcgcacgctgatcgaccggctcggggagacgtcgcgggtc
cgctacgtgcaggttgcgcggcgcgggacatcgatggagctgcgcacccgccaggaggcg
acgtcatga

DBGET integrated database retrieval system