KEGG   Pseudonocardia dioxanivorans: Psed_3077Help
Entry
Psed_3077         CDS       T01479                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00010  Glycolysis / Gluconeogenesis
pdx00020  Citrate cycle (TCA cycle)
pdx00620  Pyruvate metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01200  Carbon metabolism
Module
pdx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_3077
   00020 Citrate cycle (TCA cycle)
    Psed_3077
   00620 Pyruvate metabolism
    Psed_3077
Enzymes [BR:pdx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Psed_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AEA25276
UniProt: F4CSX7
Position
3283903..3285249
Genome map
AA seq 448 aa AA seqDB search
MSTQIFTLPDLGEGLTEAELVRWLVEVGDTVAVDAPVAEVETAKATVEVPSPFGGVIAEL
HGEEGATLSVGAPLISVTTESVSRAAQTYVEEERAGSGNVLIGYGTSEAAPSRRRRTGSA
TPATATATATATATNGPGRRPAGERPPVISPIVRQLARRAGVDLTTLAGTGPNGLITRRD
VESAVAAQTTVTASESRAAQPQQSPRAEDGVDRRTGLPIRTRVPLTGLRKAVTETLSRSR
SEIPEATTWVDVDATALLDLRAQLELNATGRAPGVLAMVARFVVAGLARHPELNARVDTE
RGEVVHLDGVNLGLAAQTDRGLVVPAVSDAHRLTMRGLDAEIRRLTTAAREGTATAAELT
SGSFTLNNYGVLGVDGSAAIINHPEVAILGLGRIIARPWVVDDAIVVRQIVQLSLVFDHR
VCDGGTAGGFLRFVADAIESPTSALADL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacgcagatcttcacccttcccgacctgggggaggggctcaccgaggccgagctg
gtccggtggctggtcgaggtcggcgacacggtcgcggtcgacgcacccgtggccgaggtc
gagacagcgaaggcgacggtcgaagtgccctcgccgttcgggggcgtgatcgcagagctg
cacggtgaggagggcgccacgctgagcgtcggcgcgccgctgatctccgtcaccaccgag
agcgtgtcgagggccgcgcagacctatgtggaagaggagcgagccgggtcgggcaacgtc
ctgatcgggtacggcacgtccgaggccgccccgtcgcggcgtcggcgcacgggctcggca
acgcccgccaccgccaccgccaccgccaccgccaccgccaccaacggacccgggcgccgc
cccgcgggcgagcgacccccggtgatctcgccgatcgtgcgccaactcgcccgtcgtgcg
ggcgtggacctcaccacgctggccgggacgggcccgaacgggctgatcacccgccgggac
gtcgagtccgccgttgcggcgcaaacgaccgtcacggcgagtgagtcccgcgccgcgcag
ccgcagcagtcaccgagggccgaggacggcgtggaccgccggaccgggctgccgatccgc
acccgggtgccgctcacgggcctacgcaaggccgtcaccgagacgctgtcgcgcagccgt
tcggagatccccgaggccaccacctgggtggacgtggatgcgacggcgctgctggatctg
cgcgcacagctcgagctcaacgcgaccggccgggcgccaggcgtcctggcgatggtcgcg
cggttcgtggtggccggtctggcccggcaccccgagctcaacgcgcgggtggacaccgag
cgcggcgaggtcgtccacctcgacggcgtcaacctcggcctggccgcccagaccgaccgt
ggcctcgtggttccggccgtctccgatgcgcaccgcctgaccatgcgcggtctcgacgcc
gagatccgcaggctgaccacggcggcccgcgaggggaccgcgaccgcggccgagctgacc
tccggctcgttcaccctgaacaactacggcgtgctcggggtcgacggcagcgctgcgatc
atcaaccatcccgaggtcgccatcctcggcctgggccgcatcatcgcacggccctgggtg
gtcgacgacgcgatcgtcgtccggcagatcgtccagctgtcgctggtgttcgaccaccgg
gtgtgcgacggcggcacggcgggcgggttcctgcgcttcgtcgccgacgccatcgagtcc
ccgacctcggcacttgccgacctgtga

DBGET integrated database retrieval system