KEGG   Pseudonocardia dioxanivorans: Psed_3714Help
Entry
Psed_3714         CDS       T01479                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Psed_3714
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Psed_3714
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Psed_3714
    1.1.1.-  
     Psed_3714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc TrkA_N AdoHcyase_NAD 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEA25884
UniProt: F4CJM4
Position
3972089..3973138
Genome map
AA seq 349 aa AA seqDB search
MRAGVFRGKGRIEVEDVPDPVAGPDDVVLDLYGCGVCGSDIGQFRSGTARAGQVMGHEFA
GTVVEVGSRVQGIVEGDRLTGLPIQPCGDCRRCRAGLAHLCERWTTRSIAFGLPGGFAER
LHIPAARLGHNVHRLPDLPGGAGAALEAGTLVEPLSVAVHAVRLADAGPGRSAVVTGLGT
IGLQAAQTLRAKGCTPVIGVDPSPLRRSVAEGLGIVTVDPTVGEEALAGTLSALTGEAEA
DIVVEASGVGALVAGAIEIVRPRGTVVLVALYHSPATIEPMRAVQREVVLRGSANVTPED
FRDSLELVGSGAVATAPLISHRMPLERVQEAFEAQLDARASVKVLVTTS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccggggtgttccgcggcaagggccgcatcgaggtcgaggacgtgcccgatccc
gtggccggccccgacgatgtggtcctcgacctgtacggctgtggggtgtgcgggtccgac
atcggacagttccgctcgggcaccgcgcgggccggccaggtcatggggcacgagttcgcg
ggcacggtcgtcgaggtcggcagccgggtccagggcatcgtcgagggcgaccggctcacc
ggcctgccgatccagccgtgcggcgactgccggcgctgcagggccggactcgcgcacctg
tgcgagcgctggacgacccgcagcatcgcgttcggcctgcccggcggtttcgccgagcgg
ctgcacatccccgcggcccgcctcggccacaacgtgcaccggctgcccgacctgcccggc
ggcgccggggccgcgctggaggcggggacgctggtggagccgttgtcggtggccgtgcac
gcggtccggctcgccgacgcggggccgggccgcagtgccgtcgtcaccggcctggggacg
atcggcctgcaggcggcacaaaccctgcgcgccaagggatgcactcccgtcatcggggtg
gacccctcgccgctgcgccggtccgtggccgagggtctggggatcgtcaccgtcgacccg
accgtcggcgaggaggcgctcgccgggacgttgagcgcgctcaccggcgaggccgaggcc
gacatcgtcgtggaggccagcggcgtcggcgcgctcgtggccggcgcgatcgagatcgtc
cgcccgcgcggcacggtggtgctcgtcgcgctgtaccactcccccgcgacgatcgagccg
atgcgggccgtgcagcgcgaggtcgtgctgcgcggcagcgccaacgtcacccccgaggac
ttccgcgactcgctggagctcgtcgggtccggggccgtggcgaccgcgccgctgatcagc
caccggatgccgctggagcgggtgcaggaggccttcgaggcccagctcgacgcccgggcc
tcggtcaaggtgctcgtcacgacgagctga

DBGET integrated database retrieval system