KEGG   Pseudonocardia dioxanivorans: Psed_3910Help
Entry
Psed_3910         CDS       T01479                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00030  Pentose phosphate pathway
pdx00480  Glutathione metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01200  Carbon metabolism
Module
pdx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pdx_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psed_3910
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Psed_3910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdx04147]
    Psed_3910
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Psed_3910
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Psed_3910
Exosome [BR:pdx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Psed_3910
  Exosomal proteins of colorectal cancer cells
   Psed_3910
  Exosomal proteins of bladder cancer cells
   Psed_3910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AEA26077
UniProt: F4CN64
Position
4181879..4183273
Genome map
AA seq 464 aa AA seqDB search
MSAPVPGDVLVLFGISGDLAHKKILPALYRLTERGELTVPVVGVALTDWDTEVLRSHAAD
AVREAIEKVDDDVLQRFLGLLTLVAGDYADGSTFSRLADEVRARAEPDDPFVVHYLAVPP
SLFGTVADALATVGLHRRARLVVEKPFGHDLASARALNAALARHYTEDQVFRVDHYLGKE
SVEDLLVLRFANTVLEPLWSRTWVDRIEITMAESFDVADRGSFYDAVGTVRDVVQNHLLQ
VLAYLTMEAPRSDAADDQRDAKHALLASVRAIDPAETVRGQYTGYLDVPGVAPGSTTETF
VSVVLHIDDWRWTGVPVHIRAGKALPETLLEIDVVLQAPPRPLFTGVDTGTPPANRIRIR
LQPDSGVTFFVLAKQPGQGDVAVEVPVSVDLRQVLGLAHEPYERIFGDALVGDPAHFARF
DTLEEAWRIVAPILDPGTTPQPYAPGTWGPEGGPVTAGTTTSNA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcccgtccccggtgacgtcctcgtcctgttcgggatcagcggcgacctggcg
cacaagaagatcctgcccgcgctctaccggctgaccgagcgcggcgagctgaccgtgccg
gtcgtcggcgtcgcgttgaccgactgggacaccgaggtcctgcgcagccacgccgccgac
gccgtgcgggaggcgatcgagaaggtcgacgacgatgtgctgcaacggttcctgggcctg
ctgacgctcgtcgccggtgactacgccgacgggtcgacgttctcccggctcgccgacgag
gtccgcgcgcgggccgagcccgacgacccgttcgtcgtgcactacctcgcggtgcccccg
agcctgttcgggacggtcgccgacgcgctcgcgacggtcggcctgcaccggcgggcgcgg
ctcgtcgtcgagaagccgttcgggcacgatctcgcctcggcccgcgcgctcaacgccgcg
ctggcccggcactacaccgaggaccaggtcttccgcgtggaccactacctcggcaaggag
tccgtcgaggacctgctggtgctgcggttcgcgaacacggtcctcgagccgctgtggagc
cgcacctgggtggaccgcatcgagatcacgatggcggagagcttcgacgtcgccgaccgg
ggctcgttctacgacgccgtcggcacggtgcgcgacgtcgtgcagaaccacctgctgcag
gtgctggcgtacctgacgatggaggcgccgcgcagcgacgcggccgacgaccagcgcgac
gccaagcacgcgctgctcgcctcggtgcgggcgatcgacccggccgagaccgtccgcggc
cagtacacgggctacctcgatgtgcccggtgtcgcgccgggctcgacgacggagacgttc
gtgtcggtcgtcctgcacatcgacgactggcgctggaccggcgtgcccgtgcacatccgg
gcgggcaaggcgctgccggagacgctgctggagatcgacgtcgtcctgcaggccccgcca
cggccgctgttcaccggcgtcgacaccgggaccccgcccgccaaccggatccggatccgg
ctgcagcccgactccggcgtgacgttcttcgtgctcgccaagcagcccggccagggcgac
gtggccgtcgaggtgccggtgtcggtcgacctgcggcaggtcctcggcctcgcgcacgag
ccctacgagcggatcttcggcgacgcgctggtgggcgaccccgcccacttcgcacggttc
gacacgctcgaggaggcctggcgcatcgtcgcgccgatcctggatcccggcacgacgccg
cagccctacgcccccggcacctgggggccggagggcgggccggtcacggccggaaccaca
acgtccaacgcgtga

DBGET integrated database retrieval system