KEGG   Pseudonocardia dioxanivorans: Psed_3994Help
Entry
Psed_3994         CDS       T01479                                 

Definition
(GenBank) Aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00350  Tyrosine metabolism
pdx00360  Phenylalanine metabolism
pdx00380  Tryptophan metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Psed_3994
   00360 Phenylalanine metabolism
    Psed_3994
   00380 Tryptophan metabolism
    Psed_3994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdx04147]
    Psed_3994
Enzymes [BR:pdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Psed_3994
    4.1.1.105  L-tryptophan decarboxylase
     Psed_3994
Exosome [BR:pdx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psed_3994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEA26160
UniProt: F4CPX7
Position
4287649..4289130
Genome map
AA seq 493 aa AA seqDB search
MPDLDPDEFRRLGHAFVDWVADHRARITDHDVQPAVEPGSVRRLLTDGALAGGLPETPQP
LEELLRTVDEVVVPASTLWQHPGFFGYFPANASLASLLGELLSGGLGAQGMLWSTSPAAT
EVEQVLLDGFARALGIGEAFTFDGGGGGSIQDSASSAALVALLAALERAGGGAWRESGTD
GRERVYVTAETHSSLAKAVRVAGLGARALRVVEPVPGTVSMSPDALAAAVAADIAAGLRP
VMVCATVGTTGTGAVDPVRAVAAVAAAHDVWVHVDAAWAGVAGLCPELRHVLDGCELADS
FCTDAHKWLLTAFDASLLWVRDATALPRALSITPEYLRNAASESGAVVDYRDWQVPLGRR
FRALKLWAVVHGLGLDGLRAHLRGHVAMAVDLAAKVRAEPGLVLAAPPSLALVCLRADTG
RGPEADDAATRTLVERVNASGSAFVTHTVVDGRYVMRIAIGAVTTQPEHVAALWQRIRAD
SAALRREPVQPTA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgatctcgatcccgacgagttccgccgcctcggccacgcgttcgtcgactgggtg
gccgaccaccgcgcccgcatcaccgaccacgacgtccagcccgcggtcgaaccgggctcg
gtgcgccgcctgctgaccgacggtgccctcgcgggcgggctgccggagacgccgcagccg
ctggaggagctgctccgcaccgtcgacgaggtcgtcgtgccggcgagcacgctgtggcag
caccccgggttcttcggctacttccccgccaacgcctcgctcgcctcgctgctgggcgag
ctgctctccggcgggctgggtgcgcaggggatgctctggtcgacctcgccggccgcgacc
gaggtcgagcaggtgctgctcgacgggttcgcccgcgccctcggcatcggcgaggcgttc
acgttcgacggcgggggcggcggctcgatccaggactcggcgtcgtcggccgcgctcgtc
gcgctgctcgccgcgctggaacgggccggcggcggagcatggcgggagtcgggcaccgac
ggccgcgagcgggtctacgtcaccgcggagacgcactcgtcgctggccaaggccgtgcgc
gtcgcgggcctgggggcgcgggcgctgcgcgtcgtcgagccggtaccgggcacggtctcg
atgtcgcccgacgcgctcgccgccgccgtcgccgcggacatcgccgccgggctgcggccg
gtcatggtgtgcgcgaccgtcggcaccaccggcacgggggcggtcgacccggtgcgtgcc
gtcgccgccgtcgccgcggcccacgacgtctgggtgcacgtcgacgccgcctgggccggc
gtggccgggctctgccccgagctgcggcacgtgctcgacggctgcgagctcgccgactcc
ttctgcaccgatgcccacaagtggctgctcaccgcgttcgacgcctccttgctgtgggtc
cgcgacgcgacggccctgccgcgggcgctctcgatcaccccggagtacctgcgcaacgcg
gccagcgagtccggcgcggtcgtggactaccgggactggcaggtcccgctgggcaggcgg
ttccgggcgctgaagctgtgggccgtcgtgcacgggctcggcctcgacgggctgcgggcg
cacctgcgcgggcacgtggcgatggccgtcgacctcgccgcgaaggtgcgcgccgagcca
ggcctggtgctcgcggcgccaccgtcgctcgcgttggtgtgcctgcgcgccgacaccggc
cggggcccggaggccgacgacgccgcgacgcggacgctggtcgagcgggtgaacgcgtcg
gggtcggcgttcgtgacccacacggtcgtcgacggtcggtacgtgatgcggatcgcgatc
ggcgcggtcacgacgcagcccgagcacgtcgcggccctgtggcagcgaatccgcgccgac
agcgccgcgctgcggagggagcccgtgcaaccgacagcatga

DBGET integrated database retrieval system