KEGG   Pseudoalteromonas espejiana: PESP_a0735Help
Entry
PESP_a0735        CDS       T04989                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase, alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pea  Pseudoalteromonas espejiana
Pathway
pea00620  Pyruvate metabolism
pea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PESP_a0735 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pea02000]
    PESP_a0735 (oadA)
Enzymes [BR:pea01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PESP_a0735 (oadA)
Transporters [BR:pea02000]
 Other transporters
  Primary active transporters [TC:3]
   PESP_a0735 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 Peptidase_M23 GCV_H EcsC RnfC_N
Motif
Other DBs
NCBI-ProteinID: ASM48948
UniProt: A0A221I519
Position
I:722001..723779
Genome map
AA seq 592 aa AA seqDB search
MAKLKLTELVLRDAHQSLLATRMRLDDMLPIASKLDDAGYWSIESWGGATFDSCIRYLGE
DPWERIRALKKAMPNTKQQMLLRGQNLLGYRHYADDVVEKFVERAHKNGVDVFRIFDAMN
DVRNLETAIKAAVKVGAHAQGTISYTVSPVHTLDMWLTLAKQLEDLGCHSICIKDMAGLL
KPYDAEQLIKGLKETVSIPIAMQCHATTGLSTATYQKAIDAGIDMLDTAISSMSMTYGHS
ATETIVAIVEGTARDTELDLNQLEEIAAYFRDVRKKYAAFEGSLKGVDGRILLAQVPGGM
LTNMENQLKEQGAADKLNEVLLEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKT
ITKETAGVLKGEYGLTPAPMNKELQERVLDGQDVITCRPADNIAPELASLEAELQKEAQE
QGLTLADEQIDDVLTYALFPQVGLKFIKNRNNPDAFEAVPSADDSNSKPAAKPANNKGVT
AEQYSVKVDGKVYDVVVAQGGELKEVSLKDSEHLPQSASVASGETLNAPLAGNIFKVKVK
AGQAVNEGDVVVIMEAMKMETEVRAMHSGTVAEVLVSEGDAVTTGDAIIAMA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaattaaaattaacagaacttgttttacgcgacgcgcaccagtcgttacttgct
acacgcatgcgcttagacgatatgcttcctattgctagcaagcttgatgatgcaggttac
tggtctattgaatcgtggggcggcgcaacatttgattcgtgtattcgttatttaggtgaa
gatccgtgggagcgtatacgcgcacttaaaaaggcaatgcctaatactaaacagcaaatg
ctattacgcggtcaaaacttgttaggttaccgccattacgctgatgacgtagtagaaaag
tttgtagagcgagcgcacaaaaatggcgttgatgtatttcgtatttttgacgcgatgaac
gatgtgcgtaacttagaaactgcaataaaagcagctgttaaagtaggcgcccatgcacaa
gggactatttcgtacactgtaagccctgtacatactcttgatatgtggctaacgcttgca
aaacaattagaagatttaggttgtcactctatttgtattaaagacatggccggtttatta
aaaccatatgatgccgagcagctaataaaaggccttaaagaaaccgtttctattcctatt
gcaatgcagtgccatgcaacaacagggcttagtactgcaacatatcaaaaagccattgat
gccggtattgatatgcttgatacagctatttcatcaatgagtatgacttacggacactca
gccacagaaactatagtggcaattgttgagggaaccgcacgcgatactgaacttgattta
aaccagcttgaagaaatagctgcttactttagagatgttcgtaaaaaatacgcagccttt
gaaggtagccttaaaggtgttgatggccgtatattactcgcgcaagtacctggcggcatg
ttaaccaacatggaaaatcaacttaaagagcaaggcgctgctgataagctaaacgaggtg
ttacttgaaattccgcgtgtgcgtgaagatttaggctttattccgcttgttacaccaaca
tcgcaaattgtaggtacacaagctgtacttaatgtgcttactggcgagcgttacaaaacc
attactaaagaaaccgccggtgtactaaaaggtgagtacggcttaacacccgcacctatg
aataaagagctgcaagaacgtgtgcttgatgggcaagatgtaattacgtgtcgccctgct
gataatattgcacctgagcttgcatcacttgaagcagaacttcaaaaagaagcgcaagaa
caaggtttaactctggctgatgagcaaatagatgatgtactcacttatgcgttattccca
caagttggccttaaatttattaaaaaccgtaataacccagatgcctttgaagcagtacca
agtgccgatgattcaaactctaaaccagctgcaaaacctgcaaacaacaaaggcgttacc
gctgaacaatatagcgtgaaagtagacggtaaagtttacgatgttgttgtagcgcaaggt
ggtgagcttaaagaagtatcgcttaaagattctgagcatttacctcaatcagcatcggtt
gcatcaggcgaaacattaaacgcgccactggctggtaatatttttaaagtaaaagtaaaa
gcaggacaagccgtaaatgaaggcgatgttgttgtgattatggaagcgatgaaaatggaa
actgaggttcgtgcaatgcactctggtaccgttgccgaagttttagtatctgaaggtgat
gctgtaactactggtgatgcaattatagcgatggcgtag

DBGET integrated database retrieval system