KEGG   Pseudoalteromonas espejiana: PESP_a1888Help
Entry
PESP_a1888        CDS       T04989                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pea  Pseudoalteromonas espejiana
Pathway
pea00071  Fatty acid degradation
pea00072  Synthesis and degradation of ketone bodies
pea00280  Valine, leucine and isoleucine degradation
pea00310  Lysine degradation
pea00362  Benzoate degradation
pea00380  Tryptophan metabolism
pea00620  Pyruvate metabolism
pea00630  Glyoxylate and dicarboxylate metabolism
pea00640  Propanoate metabolism
pea00650  Butanoate metabolism
pea00900  Terpenoid backbone biosynthesis
pea01100  Metabolic pathways
pea01110  Biosynthesis of secondary metabolites
pea01120  Microbial metabolism in diverse environments
pea01130  Biosynthesis of antibiotics
pea01200  Carbon metabolism
pea01212  Fatty acid metabolism
pea02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PESP_a1888 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PESP_a1888 (atoB)
   00640 Propanoate metabolism
    PESP_a1888 (atoB)
   00650 Butanoate metabolism
    PESP_a1888 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PESP_a1888 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PESP_a1888 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PESP_a1888 (atoB)
   00310 Lysine degradation
    PESP_a1888 (atoB)
   00380 Tryptophan metabolism
    PESP_a1888 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PESP_a1888 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PESP_a1888 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PESP_a1888 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pea04147]
    PESP_a1888 (atoB)
Enzymes [BR:pea01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PESP_a1888 (atoB)
Exosome [BR:pea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PESP_a1888 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASM49939
UniProt: A0A221I7X7
Position
I:complement(1824195..1825388)
Genome map
AA seq 397 aa AA seqDB search
MTELTGNSVVILSAVRSPIGSFGGSLKNFTPAELGTLCAKEAIIRAKLSPTQIDSCIVGK
VIHNGPKDAYLSRVIGLDAGLPINSHAVTLNRLCGSGLEAIIQAAQQIQLGDVDTVLAGG
AESMSSTSYTLDSNRWGQKMGNSTLIDELTTTLQDPWDNNPMGITAENIATKYAISREEQ
DSYAALSHHKAAKAIAAGHFKDQIIPVDIKSRKNSYIFDTDEHVRADTTLEKLAMLKPHF
KTDGIVTAATSSGINDGAAMLVLMNEQKAVAQNLKPLGRLIAYARVGVEPSLMGIGPIPA
VQEVLRKTGLSVDDMDVIESNEAFAVQALCVANELSFPQHKVNPNGGAIALGHPVGATGA
ILSTKCLYELKRINGKYGLVTMCIGGGQGIAAIYEAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattaacaggtaatagcgttgttatattaagcgcagtgcgaagccctatcggc
agctttggaggaagtcttaaaaactttacgcctgctgaacttgggaccctttgcgctaaa
gaagccattattagagcaaaattatcccccacccaaatcgattcttgtattgtaggcaaa
gtcattcataacggtccaaaagatgcctacctttcaagagtgattggtttagacgccggg
ctacctattaacagccacgccgtaacattaaatagattatgtggctctggcttagaagca
ataatacaagccgcacaacaaattcagttaggcgatgtagacacagtattagcgggtgga
gcagaaagcatgagtagcaccagttatacacttgacagtaatcgttggggccaaaaaatg
ggcaacagtacacttattgatgaattaacgaccacattacaagatccatgggataacaat
cctatgggtataaccgctgaaaacattgctactaaatacgcaattagccgagaagaacaa
gatagctatgcagctctaagtcatcataaagcagccaaagccattgccgctgggcacttc
aaagatcaaataataccagtcgacattaaatctcgtaaaaacagctatatatttgatact
gatgagcacgtacgtgctgatacaactcttgaaaagctggcaatgttaaagccgcacttt
aaaacagatggcattgtaacagctgcaacctcatcaggtataaatgatggagccgctatg
cttgtacttatgaatgagcaaaaagcggtcgctcagaacttaaaacctttaggccgttta
attgcttatgcgcgtgtgggtgttgaaccttcacttatgggtattggaccaataccggcc
gtgcaagaggtattaagaaaaacagggctatctgttgatgatatggatgtaattgaatct
aacgaagcctttgctgtacaagcattatgtgtagctaacgagctaagttttcctcagcac
aaagttaaccctaacggtggtgcaatagcattagggcatccagttggtgcaacaggtgct
attttatccactaaatgtttatacgagctaaagcgcataaacggtaaatatggcttagta
actatgtgtattggtggtggccaagggatcgcagcaatttacgaagcgctataa

DBGET integrated database retrieval system