KEGG   Pectobacterium parmentieri SCC3193: W5S_0563Help
Entry
W5S_0563          CDS       T02514                                 

Definition
(GenBank) Nicotinamide-nucleotide adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00760  Nicotinate and nicotinamide metabolism
pec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    W5S_0563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pec03000]
    W5S_0563
Enzymes [BR:pec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     W5S_0563
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     W5S_0563
Transcription factors [BR:pec03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    W5S_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_19 HTH_31 CTP_transf_like HTH_26 ABC_tran Citrate_ly_lig MMR_HSR1 HTH_37 AAA_29 HTH_35 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AFI88689
UniProt: A0A0H3HZ47
Position
complement(610294..611547)
Genome map
AA seq 417 aa AA seqDB search
MSSFDYLKSAIRQKGCTLQQVADATDMTKGYLSQLLNAKIKSPSAQKLEALHRFLELEFP
RYEKNIGIVFGKFYPLHTGHIYLIQRACSQVDELHVILGYDEPRDRLLFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHAFNEQGMEPYPHGWDVWSKGIQAFMQEKSITPNFVYTSEE
QDAAQYREHLGIEAVLIDPQRSFMNISGSQIRHDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALVDEYRFDLVILLENNTPWVADGLRSLG
STTARSEFQNLLKTMLAKNNIPYVYIKESDYDSRFLHCVELVQQMLGHDRSPEQIKS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatttgattacctgaaatccgctatccgccagaagggttgcaccctacagcag
gttgccgacgcaaccgatatgactaaaggctatctcagtcaattacttaatgccaaaatc
aaaagccctagcgcacaaaaactggaagcactgcatcgttttctcgagctggaattcccc
cgctatgaaaagaatattggtattgtcttcggcaagttctatccactacacaccggccat
atttatctgattcagcgcgcctgtagtcaggtcgatgaactgcatgtgattttaggctac
gacgaaccgcgcgaccggctgctgtttgagaacagttcgatgtcacagcagcccaccgtc
agcgaccgcctgcgctggctgctgcaaacctttaaatatcagaaaaatattcatattcac
gcctttaatgagcaaggaatggaaccctacccacacggctgggatgtgtggagtaagggt
attcaagcgttcatgcaggaaaaaagcattacgcccaatttcgtctacaccagcgaagaa
caggatgccgcgcaatatcgcgagcacctggggattgaagccgtcttgatcgacccgcag
cgatccttcatgaacatcagcggttcgcagatccgtcacgatcctttccgttactgggac
tatatcccgacagaagtgaagccgttctttgtgcgtaccgttgccattcttggcggagaa
tccagcggtaaatccacgctggtgaacaagctggctaatatcttcaacaccaccagcgcc
tgggaatatggccgcgattacgtgttctcccatctgggtggcgacgagatggcgttgcaa
tattccgactatgacaagatcgcgctgggtcaggcacagtacattgattttgcggtcaaa
tatgccaataaagtggcctttatcgacaccgactttgtcaccacgcaggcattctgcaag
aaatatgagggccgtgagcatccattcgtccaggcgctggtcgacgaataccgcttcgat
ctggtgattctgctggaaaacaatacgccttgggtagccgacggactgcgcagcttaggc
agtaccactgcccgttcggaattccagaacctgctgaaaacgatgctggctaaaaataat
atcccgtacgtttacatcaaagagtcggactacgattcacgcttcctgcactgtgtggaa
ttggtacagcaaatgttggggcacgatcggtcgcctgaacaaataaaaagctag

DBGET integrated database retrieval system